• Featured Product
  • KD/KO Validated

Endothelin 1 Polyclonal antibody

Endothelin 1 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 12191-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

EDN1, Big endothelin-1, Endothelin-1, ET 1 Big endothelin 1, ET1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inNIH/3T3 cells
Positive IHC detected inmouse lung tissue, mouse placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12191-1-AP targets Endothelin 1 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2847

Product name: Recombinant human EDN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-212 aa of BC009720

Sequence: MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSETMRNSVKSSFHDPKLKGNPSRERYVTHNRAHW

Predict reactive species
Full Name endothelin 1
Calculated Molecular Weight 212 aa, 24 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC009720
Gene Symbol Endothelin 1
Gene ID (NCBI) 1906
RRIDAB_889392
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05305
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EDN1, also named as Endothelin-1, PPET1 and ET-1, belongs to the endothelin/sarafotoxin family. Endothelins are endothelium-derived vasoconstrictor peptides. Emerging basic science, and animal and human data all suggest that EDN1 is a potentially important contributor in the pathobiology of fibrosing disorders, including those that affect the lung(PMID:20055532 ).

Protocols

Product Specific Protocols
WB protocol for Endothelin 1 antibody 12191-1-APDownload protocol
IHC protocol for Endothelin 1 antibody 12191-1-APDownload protocol
FC protocol for Endothelin 1 antibody 12191-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Redox Biol

Exercise protects aged mice against coronary endothelial senescence via FUNDC1-dependent mitophagy

Authors - Lijie Ma
humanWB,IP

Cancer Res

Lactoferrin-endothelin-1 axis contributes to the development and invasiveness of triple-negative breast cancer phenotypes.

Authors - Ngoc-Han Ha
humanWB

Acta Pharmacol Sin

Urolithin A promotes atherosclerotic plaque stability by limiting inflammation and hypercholesteremia in Apolipoprotein E-deficient mice

Authors - Meng-Yun Xu
mouseIF

Redox Biol

Blocking mitochondrial cyclophilin D ameliorates TSH-impaired defensive barrier of artery.

Authors - Xiaojing Liu
humanWB

Int J Biol Sci

Roquin2 suppresses breast cancer progression by inhibiting tumor angiogenesis via selectively destabilizing proangiogenic factors mRNA.

Authors - Meicen Zhou
humanWB

Cancer Gene Ther

Systems analysis identifies endothelin 1 axis blockade for enhancing the anti-tumor effect of multikinase inhibitor.

Authors - Chae Young Hwang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...