• Featured Product
  • KD/KO Validated

FKBPL Polyclonal antibody

FKBPL Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 10060-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF, FC (Intra), IP, ChIP, ELISA

DIR1, FK506-binding protein-like, NG7, WAF-1/CIP1 stabilizing protein 39, WISp39

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, human brain tissue, human testis tissue, Jurkat cells, MCF-7 cells, T-47D cells, MDA-MB-453s cells
Positive IP detected inMCF-7 cells
Positive IHC detected inhuman breast cancer tissue, human testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10060-1-AP targets FKBPL in WB, IHC, IF, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0112

Product name: Recombinant human FKBPL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-237 aa of BC004168

Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL

Predict reactive species
Full Name FK506 binding protein like
Calculated Molecular Weight 349 aa, 38 kDa
Observed Molecular Weight 42-48 kDa
GenBank Accession NumberBC004168
Gene Symbol FKBPL
Gene ID (NCBI) 63943
RRIDAB_2262677
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9UIM3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBPL levels may be a prognostic indicator and determinant of response to endocrine therapy(PMID:20103631, 15664193). It can be detected the band between 38 kDa and 48 kDa by western blot.

Protocols

Product Specific Protocols
FC protocol for FKBPL antibody 10060-1-APDownload protocol
IHC protocol for FKBPL antibody 10060-1-APDownload protocol
IP protocol for FKBPL antibody 10060-1-APDownload protocol
WB protocol for FKBPL antibody 10060-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF

J Adv Res

Hsa_circ_0001402 alleviates vascular neointimal hyperplasia through a miR-183-5p-dependent regulation of vascular smooth muscle cell proliferation, migration, and autophagy

Authors - Jia-Jie Lin
humanWB

Cancer Res

FKBPL regulates estrogen receptor signaling and determines response to endocrine therapy.

Authors - McKeen Hayley D HD
humanIF

Cell Mol Life Sci

A placenta-on-a-chip model to determine the regulation of FKBPL and galectin-3 in preeclampsia

Authors - Sahar Masoumeh Ghorbanpour
humanWB

J Control Release

Delivery of RALA/siFKBPL nanoparticles via electrospun bilayer nanofibres: An innovative angiogenic therapy for wound repair.

Authors - Eoghan J Mulholland
  • KD Validated
humanWB,IHC

Clin Cancer Res

FKBPL and peptide derivatives: novel biological agents that inhibit angiogenesis by a CD44-dependent mechanism.

Authors - Valentine Andrea A
humanWB,ChIP

Oncogene

Identification of RBCK1 as a novel regulator of FKBPL: implications for tumor growth and response to tamoxifen.

Authors - C Donley
Loading...
||
New chat

Able

正在加载,请稍候...