FKBPL Monoclonal antibody

FKBPL Monoclonal Antibody for WB, ELISA
Cat No. 60030-1-Ig
Clone No.5D9A9

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse

Applications

WB, ELISA

DIR1, FK506 binding protein like, FKBPL, NG7, WISP39

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse ovary tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60030-1-Ig targets FKBPL in WB, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0112

Product name: Recombinant human FKBPL protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-237 aa of BC004168

Sequence: ETPPVNTIGEKDTSQPQQEWEKNLRENLDSVIQIRQQPRDPPTETLELEVSPDPASQILEHTQGAEKLVAELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKLGSCCRVLALGFPFGSGPPEGWTELTMGVGPWREETWGELIEKCLESMCQGEEAELQLPGHSGPPVRLTLASFTQGRDSWELETSEKEALAREERARGTELFRAGNPEGAARCYGRAL

Predict reactive species
Full Name FK506 binding protein like
Calculated Molecular Weight 349 aa, 38 kDa
Observed Molecular Weight 42-48 kDa
GenBank Accession NumberBC004168
Gene Symbol FKBPL
Gene ID (NCBI) 63943
RRIDAB_2103258
Conjugate Unconjugated
FormLiquid
Purification MethodCaprylic Acid-Ammonium Sulfate Precipitation
UNIPROT IDQ9UIM3
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FKBPL, also named as DIR1, NG7 and WISp39, has similarity to the immunophilin protein family, which plays a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is thought to have a potential role in the induced radioresistance, probably by increasing the rate of DNA repair in cells exposed to X rays. Also it appears to have some involvement in general stress response in the control of the cell cycle. It regulates p21 protein stability by binding to Hsp90 and p21. FKBPL is an estrogen-inducible gene that acts as a cochaperone in ERα/Hsp90 molecular complexes; furthermore, FKBPL levels may be both a prognostic indicator and determinant of response to endocrine therapy. (PMID:20103631, 15664193)

Loading...
||
New chat Able
正在加载,请稍候...