Tested Applications
Positive WB detected in | C6 cells, HEK-293 cells, human brain tissue, MCF-7 cells, Neuro-2a cells, HeLa cells, Jurkat cells, mouse kidney tissue, rat kidney tissue, mouse brain tissue, rat brain tissue |
Positive IP detected in | HEK-293 cells |
Positive IHC detected in | human lung cancer tissue, human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | sodium arsenite treated HeLa cells |
Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:1000-1:4000 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
13057-2-AP targets G3BP1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, pig, monkey, chicken, drosophila melanogaster (fruit fly) |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag3728 Product name: Recombinant human G3BP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 167-466 aa of BC006997 Sequence: PDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAPEDAQKSSSPAPADIAQTVQEDLRTFSWASVTSKNLPPSGAVPVTGIPPHVVKVPASQPRPESKPESQIPPQRPQRDQRVREQRINIPPQRGPRPIREAGEQGDIEPRRMVRHPDSHQLFIGNLPHEVDKSELKDFFQSYGNVVELRINSGGKLPNFGFVVFDDSEPVQKVLSNRPIMFRGEVRLNVEEKKTRAAREGDRRDNRLRGPGGPRGGLGGGMRGPPRGGMVQKPGFGVGRGLAPRQ Predict reactive species |
Full Name | GTPase activating protein (SH3 domain) binding protein 1 |
Calculated Molecular Weight | 466 aa, 52 kDa |
Observed Molecular Weight | 68 kDa |
GenBank Accession Number | BC006997 |
Gene Symbol | G3BP1 |
Gene ID (NCBI) | 10146 |
RRID | AB_2232034 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q13283 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GAP SH3 Binding Protein 1 (G3BP1), also named as G3BP, is an effector of stress granule (SG) assembly. SG biology plays an important role in the pathophysiology of TDP-43 in ALS and FTLD-U. G3BP1 can be used as a marker of SG. It has been shown to function downstream of Ras and play a role in RNA metabolism, signal transduction, and proliferation. G3BP1 is a ubiquitously expressed protein that localizes to the cytoplasm in proliferating cells and to the nucleus in non-proliferating cells. G3BP1 has recently been implicated in cancer biology.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for G3BP1 antibody 13057-2-AP | Download protocol |
IHC protocol for G3BP1 antibody 13057-2-AP | Download protocol |
IF protocol for G3BP1 antibody 13057-2-AP | Download protocol |
IP protocol for G3BP1 antibody 13057-2-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Cell Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules | ||
Science Ubiquitination of G3BP1 mediates stress granule disassembly in a context-specific manner. | ||
Cell ELAVL4, splicing, and glutamatergic dysfunction precede neuron loss in MAPT mutation cerebral organoids. | ||
Cell RNA Granules Hitchhike on Lysosomes for Long-Distance Transport, Using Annexin A11 as a Molecular Tether. | ||
Cell Phase Separation of FUS Is Suppressed by Its Nuclear Import Receptor and Arginine Methylation. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Nikolett (Verified Customer) (07-29-2025) | Antibody works well for western blot in 1:1000 dilution, incubated overnight in 3%BSA/PBS on human lung cancer cell lines.
|
FH Xiaochen (Verified Customer) (11-11-2024) |
![]() |
FH Xiaochen (Verified Customer) (11-11-2024) |
![]() |
FH Roy (Verified Customer) (06-12-2024) | Works great on WB (1/1000 - Overnight 4°C) - Very beautiful IF staining in non stressed (diffuse staining) and Sodium Arsenite-mediated Stress induction (Punctate staining corresponding to stress granules) in HeLa cells (1/250 - 1h at RT).
|
FH Vinny (Verified Customer) (02-20-2024) | Good product.
|
FH Andrea (Verified Customer) (10-05-2023) | Good and strong signal.
|
FH Tatyana (Verified Customer) (01-21-2023) | Used for IP and WB of GFP-tagged overexpressed human G3BP1 (HEK293 cells). Lysates were subjected to IP using GFP-Trap beads. WB was done using semi-dry transfer. Antibody was used in 4% milk in TBST at 1:1,000 dilution. It could be reused up to 3 times. As the image shows, the antibody can successfully detect both endogenous and OE protein.
![]() |
FH Tobias (Verified Customer) (10-25-2022) |
|
FH Peter (Verified Customer) (10-24-2022) | Best G3BP1 antibody I've used for Western, IF and IP
|
FH Patryk (Verified Customer) (03-18-2021) | I used the antibody for immunofluorescence imaging to label stress granules induced by treating the cells with with 50µM sodium arsenite. Used the antibody at a dilution 1:100 overnight at 4°C. Worked perfectly well, strong and specific signal. I am very satisfied of this antibody and strongly recommend if for immunofluorescence.
![]() |
FH Kun (Verified Customer) (03-23-2020) | Very specific and sensitive
|
FH Biao (Verified Customer) (03-11-2020) | This antibody is very specific and good quality.
|
FH Joshua (Verified Customer) (12-28-2019) | PANC1 cells fixed in 4% paraformaldehdye. Bright localization to stress granules.
![]() |
FH Yuan (Verified Customer) (11-02-2019) | Very bright staining for stress granule on NaAsO2 treated Hela cells. 1:500 should be sufficient for IF staining.
![]() |
FH Zeinab (Verified Customer) (08-19-2019) | It worked great
|
FH Erica (Verified Customer) (05-15-2019) | Our lab has been using this antibody for IP, WB and IF for many years and it always worked well. I highly recommend this antibody, especially for IP for stress granules.
|
FH Karthik (Verified Customer) (04-24-2019) | Upon induction of sodium arsenite stress in neurons G3BP1 positive stress granules formed in 90 minutes.Cells permeabilized with 0.2% triton for 10 minutes
![]() |
FH Tian (Verified Customer) (01-23-2019) | I used it for ICC and it worked Great.
|