Tested Applications
| Positive WB detected in | mouse liver tissue, HEK-293 cells, HeLa cells, SH-SY5Y cells |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 9 publications below |
Product Information
16296-1-AP targets GHITM in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag9482 Product name: Recombinant human GHITM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC010354 Sequence: MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSME Predict reactive species |
| Full Name | growth hormone inducible transmembrane protein |
| Calculated Molecular Weight | 345 aa, 37 kDa |
| Observed Molecular Weight | 42 kDa, 25-27 kDa |
| GenBank Accession Number | BC010354 |
| Gene Symbol | GHITM |
| Gene ID (NCBI) | 27069 |
| RRID | AB_2111275 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H3K2 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GHITM, also known as MICS1, TMBIM5 or DERP2, is a mitochondrial protein which localizes in the inner membrane. GHITM is involved in mitochondrial morphology in specific cristae structures and the apoptotic release of cytochrome c from the mitochondria (PMID: 18417609). The gene of GHITM maps to chromosome 10q23.1, and encodes a 345-amino-acid protein with a calculated molecular mass of 37 kDa. The apparent molecular weight has been reported to be 42 kDa, the increased size in the protein may be due to post-translational modifications (PMID: 11416014; 16412389). GHITM can be cleaved into smaller forms of 23-27 kDa (PMID: 16412389; 18417609).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for GHITM antibody 16296-1-AP | Download protocol |
| IHC protocol for GHITM antibody 16296-1-AP | Download protocol |
| IF protocol for GHITM antibody 16296-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Early macrophage response to obesity encompasses Interferon Regulatory Factor 5 regulated mitochondrial architecture remodelling | ||
Aging Cell Chaperone-mediated autophagy degrades Keap1 and promotes Nrf2-mediated antioxidative response. | ||
Cells Transmembrane BAX Inhibitor-1 Motif Containing Protein 5 (TMBIM5) Sustains Mitochondrial Structure, Shape, and Function by Impacting the Mitochondrial Protein Synthesis Machinery.
| ||
Biochim Biophys Acta Mol Cell Res Impact of PARL-mediated mitochondrial protease activity on calcium regulation | ||
Life Sci Alliance TMBIM5 loss of function alters mitochondrial matrix ion homeostasis and causes a skeletal myopathy. |
