Gastrokine 1 Polyclonal antibody

Gastrokine 1 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 14494-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

18 kDa antrum mucosa protein, AMP 18, AMP18, BRICD1, CA11, FOV, foveolin, gastrokine 1, GKN1, Protein CA11

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman stomach tissue, mouse stomach tissue, rat stomach tissue
Positive IHC detected inhuman stomach tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14494-1-AP targets Gastrokine 1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5898

Product name: Recombinant human GKN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 35-196 aa of BC059778

Sequence: NVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Predict reactive species
Full Name gastrokine 1
Calculated Molecular Weight 22 kDa
Observed Molecular Weight 20-22 kDa
GenBank Accession NumberBC059778
Gene Symbol Gastrokine 1
Gene ID (NCBI) 56287
RRIDAB_10863653
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NS71
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Gastrokine 1 (GKN1), a stomach-specific protein also known as 18 kDa antrum mucosa protein (AMP-18) or foveolin, belongs to the gastrokine family of gastric mucus cell-secreted proteins. The human GKN1 gene has been localized in a region of chromosome 2p13 of about 6 kb and contains 6 exons. GKN1 is expressed only in normal human stomach, but is absent from gastric adenocarcinomas, gastro-esophageal adenocarcinoma cell lines, and other normal and tumor gastro-intestinal tissues. GKN1 may play an important role in normal gastric function and may be a gastric tumour suppressor.

Protocols

Product Specific Protocols
IHC protocol for Gastrokine 1 antibody 14494-1-APDownload protocol
WB protocol for Gastrokine 1 antibody 14494-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...