Tested Applications
Positive WB detected in | rat brain tissue, human heart tissue, human placenta tissue, mouse placenta tissue |
Positive IP detected in | mouse spleen tissue |
Positive IHC detected in | human lung cancer tissue, human kidney tissue, human placenta tissue, human testis tissue, human spleen tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 6 publications below |
IHC | See 4 publications below |
IF | See 1 publications below |
IP | See 1 publications below |
Product Information
13625-1-AP targets GMFG in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag4538 Product name: Recombinant human GMFG protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-141 aa of BC032819 Sequence: SDSLVVCEVDPELTEKLRKFRFRKETDNAAIIMKVDKDRQMVVLEEEFQNISPEELKMELPERQPRFVVYSYKYVHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNRLVQTAELTKVFEIRTTDDLTEAWLQEKLSFFR Predict reactive species |
Full Name | glia maturation factor, gamma |
Calculated Molecular Weight | 141 aa, 17 kDa |
Observed Molecular Weight | 17 kDa |
GenBank Accession Number | BC032819 |
Gene Symbol | GMFG |
Gene ID (NCBI) | 9535 |
RRID | AB_2110929 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O60234 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
GMFG, is a highly conserved brain-specific protein that belongs to the GMF subfamily of the larger Actin-binding protein ADF family. GMFG is preferentially expressed in blood vessel cells and immune cells and its ectopic expression enhances cellular functions such as tube-formation and migration in vitro. GMFG mediates neutrophil and T-lymphocyte migration via regulation of actin cytoskeletal reorganization. GMFG also acts as an intracellular regulator of stress-activated signal transduction by demonstrating activation of p38 MAP kinase and transcription factor NF-kB in astrocytes.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for GMFG antibody 13625-1-AP | Download protocol |
IHC protocol for GMFG antibody 13625-1-AP | Download protocol |
IP protocol for GMFG antibody 13625-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Development Coronary veins determine the pattern of sympathetic innervation in the developing heart. | ||
J Leukoc Biol Glia maturation factor-γ regulates amyloid-β42 phagocytosis through scavenger receptor AI in murine macrophages
| ||
Front Cell Dev Biol The Actin-Disassembly Protein Glia Maturation Factor γ Enhances Actin Remodeling and B Cell Antigen Receptor Signaling at the Immune Synapse.
| ||
Front Oncol GMFG Has Potential to Be a Novel Prognostic Marker and Related to Immune Infiltrates in Breast Cancer. | ||
Oncol Rep Expression of glia maturation factor γ is associated with colorectal cancer metastasis and its downregulation suppresses colorectal cancer cell migration and invasion in vitro. | ||
Genes (Basel) High Level of GMFG Correlated to Poor Clinical Outcome and Promoted Cell Migration and Invasion through EMT Pathway in Triple-Negative Breast Cancer |