• Featured Product
  • KD/KO Validated

HSPA4 Polyclonal antibody

HSPA4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA
Cat No. 21206-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, monkey

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

APG2, Heat shock 70 kDa protein 4, Heat shock 70-related protein APG-2, Heat shock protein family H member 2, hsp70RY

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inC6 cells, HEK-293 cells, mouse testis tissue, NIH/3T3 cells, mouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman colon cancer tissue, human breast cancer tissue, human pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells, HepG2 cells
Positive FC (Intra) detected inC6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

21206-1-AP targets HSPA4 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat, monkey samples.

Tested Reactivity human, mouse, rat, monkey
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag15581

Product name: Recombinant human HSPA4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 680-840 aa of BC110861

Sequence: NLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID

Predict reactive species
Full Name heat shock 70kDa protein 4
Calculated Molecular Weight 840 aa, 94 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC110861
Gene Symbol HSPA4
Gene ID (NCBI) 3308
RRIDAB_10733641
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP34932
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

HSPA4 (also known as Apg-2, HSP70RY) is a 110 kDa cytosolic protein, a member of the heat-shock protein 110 (HSP110) subfamily of HSP70 proteins which are highly conserved chaperons implicated in protein folding, protein refolding, protein transport, and protein targeting. HSPA4 is ubiquitously expressed and its expression is not heat inducible. Overexpression of HSPA4 has been reported in some leukemia and solid tumors. This antibody well recognized the endogenous HSPA4 protein in mouse brain/ testis tissues. (PMID: 21487003)

Protocols

Product Specific Protocols
WB protocol for HSPA4 antibody 21206-1-APDownload protocol
IHC protocol for HSPA4 antibody 21206-1-APDownload protocol
IF protocol for HSPA4 antibody 21206-1-APDownload protocol
IP protocol for HSPA4 antibody 21206-1-APDownload protocol
FC protocol for HSPA4 antibody 21206-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB

Int J Mol Sci

Comparative Hypothalamic Proteomic Analysis Between Diet-Induced Obesity and Diet-Resistant Rats

Authors - Pengjiao Xi
mouseWB

Int J Biochem Cell Biol

Folate deprivation induces cell cycle arrest at G0/G1 phase and apoptosis in hippocampal neuron cells through down-regulation of IGF-1 signaling pathway.

Authors - Yang Yang
humanELISA

Eur J Clin Invest

Salivary monitoring related to major surgery.

Authors - Ullmann Yehuda Y
WB

Int J Mol Sci

Quantitative Proteomic Analysis of Escherichia coli Heat-Labile Toxin B Subunit (LTB) with Enterovirus 71 (EV71) Subunit VP1.

Authors - Lin Liu
mouseWB

Int J Med Sci

Exercise combined with trimetazidine improves anti-fatal stress capacity through enhancing autophagy and heat shock protein 70 of myocardium in mice.

Authors - Lingjun Jiang
humanWB

Mol Cell Proteomics

A new cellular interactome of SARS-CoV-2 nucleocapsid protein and its biological implications

Authors - Yuan-Qin Min
Loading...
||
New chat Able
正在加载,请稍候...