Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

IMMT Polyclonal antibody

IMMT Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10179-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Cell proliferation-inducing gene 4/52 protein, HMP, MIC60, MICOS complex subunit MIC60, MINOS2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, HepG2 cells, HEK-293 cells, HeLa cells, Raji cells, mouse brain tissue, MCF-7 cells, rat brain tissue
Positive IP detected inRaji cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHEK-293T cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10179-1-AP targets IMMT in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0102

Product name: Recombinant human IMMT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 4-297 aa of BC002412

Sequence: ACQLSGVTAAAQSCLCGKFVLRPLRPCRRYSTSGSSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQPASQLQKQKGDTPASATAPTEAAQIISAAGDTLSVPAPAVQPEESLKTDHPEIGEGKPTPALSEEASSSSIRERPPEEVAARLAQQEKQEQVKIESLAKSLEDALRQTASVTLQAIAAQNAAVQAVNAHSNILKAAMDNSEIAGEKKSAQWRTVEGALKERRKAVDEAADALLK

Predict reactive species
Full Name inner membrane protein, mitochondrial (mitofilin)
Calculated Molecular Weight 90 kDa
Observed Molecular Weight 80-90 kDa
GenBank Accession NumberBC002412
Gene Symbol IMMT
Gene ID (NCBI) 10989
RRIDAB_2127193
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16891
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

IMMT (also known as mitofilin) is an inner mitochondrial membrane protein that is preferentially expressed in heart tissue and is commonly used as the marker for mitochondria. Mitofilin is known to be a critical organizer of mitochondrial cristae morphology and is indispensable for normal mitochondrial function. Three isoforms of mitofilin exist due to the alternative splicing. All three proteins of 87kD, 89kD and 80kD can be detected in immunoblot analysis with this antibody.

Protocols

Product Specific Protocols
FC protocol for IMMT antibody 10179-1-APDownload protocol
IF protocol for IMMT antibody 10179-1-APDownload protocol
IHC protocol for IMMT antibody 10179-1-APDownload protocol
IP protocol for IMMT antibody 10179-1-APDownload protocol
WB protocol for IMMT antibody 10179-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
human

Nat Methods

Optimal precision and accuracy in 4Pi-STORM using dynamic spline PSF models.

Authors - Mark Bates
humanWB

Cell Metab

Liver mitochondrial cristae organizing protein MIC19 promotes energy expenditure and pedestrian locomotion by altering nucleotide metabolism

Authors - Jee Hyung Sohn
mouseWB

Cell Metab

A cold-stress-inducible PERK/OGT axis controls TOM70-assisted mitochondrial protein import and cristae formation.

Authors - Pedro Latorre-Muro
WB

Cell Metab

The Ca(2+)-Dependent Release of the Mia40-Induced MICU1-MICU2 Dimer from MCU Regulates Mitochondrial Ca(2+) Uptake.

Authors - Carmelina Petrungaro
humanWB

Mol Cell

Mitochondrial DNA breaks activate an integrated stress response to reestablish homeostasis

Authors - Yi Fu
humanWB

Mol Cell

The interplay between BAX and BAK tunes apoptotic pore growth to control mitochondrial-DNA-mediated inflammation.

Authors - Katia Cosentino

Reviews

    4.8 out of 5
Add a review

6 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Mia (Verified Customer) (09-28-2022)

very clear band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mitochondria protein

siiting (Verified Customer) (03-20-2022)

very good antibody, second time buy already

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: mouse tissue

Maria (Verified Customer) (08-15-2021)

Mitofilin in human primary fibroblasts. Blocking with 5% milk in PBST (0.1%t tween) 1h RT. Primary ab 1:1000 in BSA 3% in PBST O/N at 4º incubation. Secondary 1:5000 HRP 1h RT.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Human primary fibroblasts
IMMT Antibody Western Blot validation (1:1000 dilution) in Human primary fibroblasts (Cat no:10179-1-AP)

CYNTHIA (Verified Customer) (07-16-2020)

I used the mitofilin on my WB samples at the beginning it was great but in 3 times of using it i couldn't understand why it doesn't work. but i recommend ure antibodies to my colleagues

  • Applications: Western Blot

SITING (Verified Customer) (07-13-2020)

SHOW VERY STRONG SIGNAL

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: MOUSE HEART

Yan (Verified Customer) (01-28-2020)

This antibody worked very well on mouse heart tissue for western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse heart tissue
Loading...
||
New chat

Able

正在加载,请稍候...