Tested Applications
Positive IP detected in | DU 145 cells |
Positive IHC detected in | human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
IHC | See 1 publications below |
IF | See 1 publications below |
Product Information
26547-1-AP targets KLK4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24240 Product name: Recombinant human KLK4 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 67-114 aa of BC069325 Sequence: LSAAHCFQNSYTIGLGLHSLEADQEPGSQMVEASLSVRHPEYNRPLLA Predict reactive species |
Full Name | kallikrein-related peptidase 4 |
Calculated Molecular Weight | 254 aa, 27 kDa |
Observed Molecular Weight | 30 kDa |
GenBank Accession Number | BC069325 |
Gene Symbol | KLK4 |
Gene ID (NCBI) | 9622 |
RRID | AB_2880548 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y5K2 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for KLK4 antibody 26547-1-AP | Download protocol |
IP protocol for KLK4 antibody 26547-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Am J Pathol Kallikrein-Related Peptidase 4 Promotes Proliferation, Migration, Invasion, and Pro-Angiogenesis of Endometrial Stromal Cells via Regulation of Brain-Derived Neurotrophic Factor Production in Endometriosis | ||