Tested Applications
| Positive WB detected in | mouse skin tissue, A431 cells, rat skin tissue |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue, human lung cancer tissue, human skin cancer tissue, rat skin tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse skin tissue |
| Positive IF/ICC detected in | A431 cells |
| Positive FC (Intra) detected in | A431 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 8 publications below |
| IHC | See 8 publications below |
| IF | See 15 publications below |
Product Information
18343-1-AP targets Cytokeratin 10 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13136 Product name: Recombinant human KRT10 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 235-584 aa of BC034697 Sequence: RLKYENEVALRQSVEADINGLRRVLDELTLTKADLEMQIESLTEELAYLKKNHEEEMKDLRNVSTGDVNVEMNAAPGVDLTQLLNNMRSQYEQLAEQNRKDAEAWFNEKSKELTTEIDNNIEQISSYKSEITELRRNVQALEIELQSQLALKQSLEASLAETEGRYCVQLSQIQAQISALEEQLQQIRAETECQNTEYQQLLDIKIRLENEIQTYRSLLEGEGSSGGGGRGGGSFGGGYGGGSSGGGSSGGGYGGGHGGSSGGGYGGGSSGGGSSGGGYGGGSSSGGHGGSSSGGYGGGSSGGGGGGYGGGSSGGGSSSGGGYGGGSSSGGHKSSSSGSVGESSSKGPRY Predict reactive species |
| Full Name | keratin 10 |
| Calculated Molecular Weight | 584 aa, 59 kDa |
| Observed Molecular Weight | 50-59 kDa |
| GenBank Accession Number | BC034697 |
| Gene Symbol | Cytokeratin 10 |
| Gene ID (NCBI) | 3858 |
| RRID | AB_10863654 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P13645 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. As a type I keratin, keratin 10 is a suprabasal marker of differentiation in stratified squamous epithelia.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for Cytokeratin 10 antibody 18343-1-AP | Download protocol |
| IF protocol for Cytokeratin 10 antibody 18343-1-AP | Download protocol |
| IHC protocol for Cytokeratin 10 antibody 18343-1-AP | Download protocol |
| WB protocol for Cytokeratin 10 antibody 18343-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Bioact Mater Biomimetic gender-specific human skin model based on gonads/epidermis-on-a-chip | ||
Cell Mol Biol Lett The role of NPY2R/NFATc1/DYRK1A regulatory axis in sebaceous glands for sebum synthesis | ||
Aging Cell Nociceptive transient receptor potential canonical 7 (TRPC7) mediates aging-associated tumorigenesis induced by ultraviolet B. | ||
Life Sci The potential of Diosgenin in treating psoriasis: Studies from HaCaT keratinocytes and imiquimod-induced murine model. | ||
mBio Commensal-Related Changes in the Epidermal Barrier Function Lead to Alterations in the Benzo[a]Pyrene Metabolite Profile and Its Distribution in 3D Skin. | ||
Cell Death Differ The parkin-γ-tubulin axis regulates epidermal homeostasis and is associated with the susceptibility to psoriasis. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Joshua (Verified Customer) (07-27-2019) | Cells differentiated at air-liquid interface. Cells fixed in 4% paraformaldehyde and stained at 4C overnight. Bright staining with minimal background.
![]() |






































