Cytokeratin 7 Polyclonal antibody

Cytokeratin 7 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA

Cat No. 15539-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA

KRT7, CK 7, CK7, CK-7, Cytokeratin,Keratin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, rat liver tissue, A431 cells, mouse liver tissue, mouse bladder tissue, HepG2 cells, mouse lung tissue, rat bladder tissue, rat lung tissue
Positive IHC detected inhuman pancreas tissue, human bowen disease, human breast cancer tissue, human kidney tissue, human lung tissue, human lung cancer tissue, human ovary tumor tissue, human stomach cancer tissue, mouse kidney tissue, mouse pancreas tissue, rat kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse pancreas tissue, rat liver tissue
Positive IF-Fro detected inmouse breast cancer
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:1000-1:30000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15539-1-AP targets Cytokeratin 7 in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7895

Product name: Recombinant human CK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-351 aa of BC002700

Sequence: MSIHFSSPVFTSRSAAFSGRGAQVRLSSARPGGLGSSSLYGLGASRPRVAVRSAYGGPVGAGIREVTINQSLLAPLRLDADPSLQRVRQEESEQIKTLNNKFASFIDKVRFLEQQNKLLETKWTLLQEQKSAKSSRLPDIFEAQIAGLRGQLEALQVDGGRLEAELRSMQDVVEDFKNKYEDEINRRTAAENEFVVLKKDVDAAYMSKVELEAKVDALNDEINFLRTLNETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDAR

Predict reactive species
Full Name keratin 7
Calculated Molecular Weight 469 aa, 51 kDa
Observed Molecular Weight 51 kDa
GenBank Accession NumberBC002700
Gene Symbol Cytokeratin 7
Gene ID (NCBI) 3855
RRIDAB_2249769
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08729
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cytokeratin 7 (CK7) is a type II keratin protein that is a principal constituent of the intermediate filament cytoskeleton. It is primarily expressed in simple epithelia lining the cavities of internal organs, glandular ducts, and blood vessels. Abnormal expression of CK7 has been linked to various pathological conditions, including cancer. Overexpression of CK7 promotes tumor progression and metastasis in different human cancers, and its suppression leads to rapid tumor regression, highlighting its potential as a therapeutic target CK7 is also involved in inhibiting interferon-dependent interphase, promoting DNA synthesis, initiating translation possibly through interaction with p150 (the largest subunit of eukaryotic translation initiation factor 3), and interacting with G protein-coupled estrogen receptor 1 (GPER1), which activates several signaling pathways. In the context of cancer diagnosis, CK7 is used as a marker to distinguish between different types of carcinomas. It is expressed in most adenocarcinomas, particularly those of the lung and colorectal origin, and is useful in differentiating primary ovarian carcinoma from metastatic colorectal carcinoma. CK7 expression has also been studied as a predictor of an unfavorable prognosis in colorectal carcinoma.

Protocols

Product Specific Protocols
FC protocol for Cytokeratin 7 antibody 15539-1-APDownload protocol
IF protocol for Cytokeratin 7 antibody 15539-1-APDownload protocol
IHC protocol for Cytokeratin 7 antibody 15539-1-APDownload protocol
WB protocol for Cytokeratin 7 antibody 15539-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
IF

Cell

Neurulation of the cynomolgus monkey embryo achieved from 3D blastocyst culture

Authors - Jinglei Zhai
mouseIHC

Cancer Cell

Promotion of cholangiocarcinoma growth by diverse cancer-associated fibroblast subpopulations.

Authors - Silvia Affo
humanIF

J Nanobiotechnology

GelMA loaded with exosomes from human minor salivary gland organoids enhances wound healing by inducing macrophage polarization

Authors - Jiaying Qian
humanIF

Cell Death Dis

α1,3-fucosylation of MEST promotes invasion potential of cytotrophoblast cells by activating translation initiation

Authors - Hao Wang
mouseIF

Free Radic Biol Med

Pasteurized Akkermansia muciniphila ameliorates preeclampsia via inhibiting mitochondrial dysfunction-mediated placental apoptosis in vivo and in vitro

Authors - Haizhen Wang
humanWB,IHC,IF

Apoptosis

PANoptosis subtypes predict prognosis and immune efficacy in gastric cancer

Authors - Zitao Liu
Loading...
||
New chat

Able

正在加载,请稍候...