Tested Applications
| Positive WB detected in | mouse heart tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive FC (Intra) detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
21774-1-AP targets CACNA1C in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, rabbit, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16455 Product name: Recombinant human L-VOCC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1835-2135 aa of BC146846 Sequence: EVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFATPPATPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRVRPVSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEMESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRPSEEELQDSRVYVSSL Predict reactive species |
| Full Name | calcium channel, voltage-dependent, L type, alpha 1C subunit |
| Calculated Molecular Weight | 249 kDa |
| Observed Molecular Weight | 249 kDa |
| GenBank Accession Number | BC146846 |
| Gene Symbol | CACNA1C |
| Gene ID (NCBI) | 775 |
| RRID | AB_2878918 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q13936 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Calcium voltage-gated channel subunit alpha1 C (CACNA1C, also known as CACH2 and Cav1.2) couples transient activation of inward calcium current to transcriptional regulation and plays an important role in dendritic development, neuronal survival, synaptic plasticity, memory formation, learning, and behavior (PMID: 21248242; 16251435; 20169575; 19047462; 18174367). Genetic variation in CACNA1C has also been associated with depression, schizophrenia, and autism spectrum disorders, as well as changes in brain function and structure in control subjects who have no diagnosable psychiatric illness (PMID: 22705413).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| IF protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| IHC protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| WB protocol for CACNA1C antibody 21774-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CACNA1C polyclonal antibody (Cat# 21774-1-AP) has accumulated 36 citations across 35 journals, including Cell Metabolism, Science Advances, Advanced Science, EBioMedicine, Communications Biology, and Journal of Translational Medicine. Research fields span cardiovascular disease (arrhythmia, atrial fibrillation, myocardial infarction), neuroscience (dopamine signaling, alcohol use disorder), calcium channel biology, metabolic regulation, reproductive medicine, oncology, and pharmacology/toxicology.
| Species | Application | Title |
|---|---|---|
Cell Metab Hepatocyte-to-intestinal stem cell remote communication regulates blood glucose homeostasis. | ||
Adv Sci (Weinh) Deficiency of SCAMP5 Triggers Pancreatic β-Cell Secretory Dysfunction and Apoptosis. | ||
Sci Adv α-Synuclein expression is required for somatodendritic dopamine release and immediate early gene induction. | ||
Phytomedicine Protective role and mechanism of snakegourd peel against myocardial infarction in rats. | ||
EBioMedicine Patient-specific iPSC-derived cardiomyocytes reveal variable phenotypic severity of Brugada syndrome | ||
Mater Today Bio A bioinspired anisotropic anti-inflammatory scaffold enhances spinal nerve regeneration and neural circuit reconstruction via FGF13/Ca(2+)/CaMK2A/CREB pathway. |
Reviews
What customers say
One reviewer (Wu Su) rated this product 5 out of 5 stars in July 2021. They used lot 00014709 at a 1:100 dilution for immunohistochemistry on glandular lumen tissue and reported that it "works good for IHC assay." Overall, the single review is positive, confirming reliable performance in IHC applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Wu (Verified Customer) (07-16-2021) | Works good for IHC assay
 |
