Tested Applications
Positive WB detected in | mouse cerebellum tissue, human brain tissue |
Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF-P detected in | mouse brain tissue |
Positive FC (Intra) detected in | SH-SY5Y cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 13 publications below |
IHC | See 1 publications below |
IF | See 5 publications below |
CoIP | See 1 publications below |
Product Information
21633-1-AP targets MAP1B in WB, IHC, IF-P, FC (Intra), CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16255 Product name: Recombinant human MAP1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 414-567 aa of BC141853 Sequence: DSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPVKTETKPSVTEKEVPSKEEPSPVKAEVAEKQATDVKPKAAKEKTVKKETKVKPEDKKEEKEKPKKEVAKKEDKTPIKKEEKPKKEEVKKEVKKEIKKEEK Predict reactive species |
Full Name | microtubule-associated protein 1B |
Calculated Molecular Weight | 2468 aa, 271 kDa |
Observed Molecular Weight | 320 kDa |
GenBank Accession Number | BC141853 |
Gene Symbol | MAP1B |
Gene ID (NCBI) | 4131 |
RRID | AB_10793666 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P46821 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Microtubule-associated protein 1B (MAP1B) is a cytoskeleton protein which can promote microtubule assembly. Previous reports have suggested that this protein is closely involved in neuronal development based on its extensive expression in the developing brain and moderate in mature neurons. Gene disruption or knockout studies of the MAP1B gene led to a delayed development of the nervous system in mice. It includes the N-terminal heavy chain and a C-terminal light chain. The MAP1B heavy chain has a microtubule-stabilization effect, and contains an actin-binding site that may play a role in the crosslinking of actin and microtubules, a function that may be important in neurite elongation. Various isoforms around 300-350 kDa of MAP1B can be observed due to the differences in phosphorylation state. (10704485)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MAP1B antibody 21633-1-AP | Download protocol |
IHC protocol for MAP1B antibody 21633-1-AP | Download protocol |
IF protocol for MAP1B antibody 21633-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Commun m6a methylation orchestrates IMP1 regulation of microtubules during human neuronal differentiation | ||
EMBO Rep MAP1B-LC1 prevents autophagosome formation by linking syntaxin 17 to microtubules.
| ||
Cereb Cortex eEF2K/eEF2 Pathway Controls the Excitation/Inhibition Balance and Susceptibility to Epileptic Seizures. | ||
Front Cell Neurosci Endothelin-1, over-expressed in SOD1G93A mice, aggravates injury of NSC34-hSOD1G93A cells through complicated molecular mechanism revealed by quantitative proteomics analysis | ||
Hum Mol Genet Microtubule associated protein 1B dysregulates microtubule dynamics and neuronal mitochondrial transport in Spinal Muscular Atrophy. | ||
Cell Cycle Depletion of JMJD5 sensitizes tumor cells to microtubule-destabilizing agents by altering microtubule stability. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Albane (Verified Customer) (02-18-2020) | A lot of bands, none at the correct size
![]() |