Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

MIF Polyclonal antibody

MIF Polyclonal Antibody for WB, IF/ICC, FC (Intra), IP, ELISA

Cat No. 20415-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), IP, ELISA

EC:5.3.2.1, EC:5.3.3.12, Glycosylation-inhibiting factor, L-dopachrome isomerase, L-dopachrome tautomerase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HL-60 cells, U-937 cells, Y79 cells, U-87 MG cells, HEK-293T cells, HUVEC cells, J774A.1 cells, Neuro-2a cells, mouse spleen tissue, rat spleen tissue, Jurkat cells
Positive IP detected inmouse spleen tissue
Positive IF/ICC detected inU-251 cells
Positive FC (Intra) detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20415-1-AP targets MIF in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14058

Product name: Recombinant human MIF protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 51-115 aa of BC000447

Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Predict reactive species
Full Name macrophage migration inhibitory factor (glycosylation-inhibiting factor)
Calculated Molecular Weight 115 aa, 12 kDa
Observed Molecular Weight 12 kDa
GenBank Accession NumberBC000447
Gene Symbol MIF
Gene ID (NCBI) 4282
RRIDAB_10694820
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP14174
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.

Protocols

Product Specific Protocols
FC protocol for MIF antibody 20415-1-APDownload protocol
IF protocol for MIF antibody 20415-1-APDownload protocol
IP protocol for MIF antibody 20415-1-APDownload protocol
WB protocol for MIF antibody 20415-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

Stem Cell Res Ther

DPSCs regulate epithelial-T cell interactions in oral submucous fibrosis

Authors - S Y Wang
mouseWB

Am J Pathol

CDR1as Deficiency Prevents Photoreceptor Degeneration by Regulating miR-7a-5p/α-syn/Parthanatos Pathway in Retinal Detachment

Authors - Feiyu Jin
humanWB

Cancer Lett

Macrophage migration inhibitory factor promotes tumor aggressiveness of esophageal squamous cell carcinoma via activation of Akt and inactivation of GSK3β.

Authors - Rui-Min Liu
  • KD Validated
humanWB

Cell Prolif

TSP50 promotes hepatocyte proliferation and tumour formation by activating glucose-6-phosphate dehydrogenase (G6PD).

Authors - Xiaojun Zhang
mouseWB

Front Endocrinol (Lausanne)

Exercise prevents fatal stress-induced myocardial injury in obese mice

Authors - Yaoshan Dun
mouseIF

Food Chem Toxicol

The crosstalk between M1 macrophage polarization and energy metabolism disorder contributes to polystyrene nanoplastics-triggered testicular inflammation

Authors - Siwen Li

Reviews

    4.6 out of 5
Add a review

5 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Tianyi (Verified Customer) (01-12-2024)

Antigen retrieval in TE buffer, incubated with AF594 for 2 h at RT

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: Ovarian tissue
MIF Antibody Immunofluorescence validation (1:200 dilution) in Ovarian tissue (Cat no:20415-1-AP)

sarah (Verified Customer) (10-27-2023)

antibody worked great for WB

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: 293T, HCT116

Sarah (Verified Customer) (01-24-2023)

This antibody worked well despite low protein concentration.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HCT116

Emma (Verified Customer) (03-15-2022)

Nice antibody have used overnight @ 1:1000 on cell lysates and conditioned media. Produces a band at the correct size.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: PC3

Ryan (Verified Customer) (02-27-2019)

Tissue was fixed in PFA with no additional antigen retrieval. Co-localisation with microglia based on known markers (not shown).

  • Applications: Immunohistochemistry, Immunofluorescence,
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Zebrafish brain (Microglia) at 3dpf
MIF Antibody Immunohistochemistry,Immunofluorescence, validation (1:100 dilution) in Zebrafish brain (Microglia) at 3dpf (Cat no:20415-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...