Tested Applications
Positive WB detected in | A549 cells, U-937 cells, Y79 cells, HL-60 cells, Jurkat cells, U-87 MG cells, HEK-293T cells, HUVEC cells, J774A.1 cells, Neuro-2a cells, mouse spleen tissue, rat spleen tissue |
Positive IP detected in | mouse spleen tissue |
Positive IF/ICC detected in | U-251 cells |
Positive FC (Intra) detected in | THP-1 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 6 publications below |
WB | See 16 publications below |
IF | See 9 publications below |
Product Information
20415-1-AP targets MIF in WB, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14058 Product name: Recombinant human MIF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 51-115 aa of BC000447 Sequence: GGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA Predict reactive species |
Full Name | macrophage migration inhibitory factor (glycosylation-inhibiting factor) |
Calculated Molecular Weight | 115 aa, 12 kDa |
Observed Molecular Weight | 12 kDa |
GenBank Accession Number | BC000447 |
Gene Symbol | MIF |
Gene ID (NCBI) | 4282 |
RRID | AB_10694820 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P14174 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MIF is a pleiotropic cytokine that contributes to the pathogenesis of many autoimmune diseases through its upstream immunoregulatory function and its polymorphic genetic locus. MIF is a highly conserved protein of 12.5 kDa, with evolutionarily ancient homologues in plants, protozoans, nematodes, and invertebrates.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for MIF antibody 20415-1-AP | Download protocol |
IF protocol for MIF antibody 20415-1-AP | Download protocol |
IP protocol for MIF antibody 20415-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Stem Cell Res Ther DPSCs regulate epithelial-T cell interactions in oral submucous fibrosis | ||
Am J Pathol CDR1as Deficiency Prevents Photoreceptor Degeneration by Regulating miR-7a-5p/α-syn/Parthanatos Pathway in Retinal Detachment | ||
Cancer Lett Macrophage migration inhibitory factor promotes tumor aggressiveness of esophageal squamous cell carcinoma via activation of Akt and inactivation of GSK3β.
| ||
Cell Prolif TSP50 promotes hepatocyte proliferation and tumour formation by activating glucose-6-phosphate dehydrogenase (G6PD). | ||
Front Endocrinol (Lausanne) Exercise prevents fatal stress-induced myocardial injury in obese mice | ||
Food Chem Toxicol The crosstalk between M1 macrophage polarization and energy metabolism disorder contributes to polystyrene nanoplastics-triggered testicular inflammation |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tianyi (Verified Customer) (01-12-2024) | Antigen retrieval in TE buffer, incubated with AF594 for 2 h at RT
![]() |
FH sarah (Verified Customer) (10-27-2023) | antibody worked great for WB
|
FH Sarah (Verified Customer) (01-24-2023) | This antibody worked well despite low protein concentration.
|
FH Emma (Verified Customer) (03-15-2022) | Nice antibody have used overnight @ 1:1000 on cell lysates and conditioned media. Produces a band at the correct size.
|
FH Ryan (Verified Customer) (02-27-2019) | Tissue was fixed in PFA with no additional antigen retrieval. Co-localisation with microglia based on known markers (not shown).
![]() |