Tested Applications
| Positive WB detected in | mouse uterus tissue |
| Positive IHC detected in | human colon tissue, rat eye tissue, mouse eye tissue, rat bladder tissue, human skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse heart tissue |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 44 publications below |
| IHC | See 3 publications below |
| IF | See 16 publications below |
Product Information
21404-1-AP targets SMMHC in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag16114 Product name: Recombinant human MYH11 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1208-1316 aa of BC104906 Sequence: LTEQLEQFKRAKANLDKNKQTLEKENADLAGELRVLGQAKQEVEHKKKKLEAQVQELQSKCSDGERARAELNDKVHKLQNEVESVTGMLNEAEGKAIKLAKDVASLSSQ Predict reactive species |
| Full Name | myosin, heavy chain 11, smooth muscle |
| Calculated Molecular Weight | 1979 aa, 228 kDa |
| Observed Molecular Weight | 220 kDa |
| GenBank Accession Number | BC104906 |
| Gene Symbol | SMMHC/MYH11 |
| Gene ID (NCBI) | 4629 |
| RRID | AB_10732819 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P35749 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SMMHC (smooth muscle myosin heavy chain; MYH11) is a contractile protein of smooth muscle cells. It is specifically expressed in cells derived from smooth muscle lineages. SMMHC is used as vascular smooth muscle cell (vSMC) contractile marker. It is also an excellent marker for myoepithelial cells, with no or few cross-reaction with myofibroblasts, thus very useful in the evaluation of stromal invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SMMHC antibody 21404-1-AP | Download protocol |
| IF protocol for SMMHC antibody 21404-1-AP | Download protocol |
| IHC protocol for SMMHC antibody 21404-1-AP | Download protocol |
| WB protocol for SMMHC antibody 21404-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest UHRF1 epigenetically orchestrates smooth muscle cell plasticity in arterial disease. | ||
Theranostics Salvia miltiorrhiza-derived miRNAs suppress vascular remodeling through regulating OTUD7B/KLF4/NMHC IIA axis. | ||
Acta Physiol (Oxf) Prostacyclin facilitates vascular smooth muscle cell phenotypic transformation via activating TP receptors when IP receptors are deficient. | ||
Biomed Pharmacother Nesfatin-1 promotes VSMC migration and neointimal hyperplasia by upregulating matrix metalloproteinases and downregulating PPARγ. | ||
Oxid Med Cell Longev Tanreqing Injection Regulates Cell Function of Hypoxia-Induced Human Pulmonary Artery Smooth Muscle Cells (HPASMCs) through TRPC1/CX3CL1 Signaling Pathway. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Tom (Verified Customer) (07-12-2023) | One of the best smooth muscle cell markers for immunofluorescence!!
|

















