NF-M Polyclonal antibody

NF-M Polyclonal Antibody for WB, IHC, IF-P, FC (Intra), ELISA
Cat No. 25805-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, FC (Intra), ELISA

NEFM, NEF3, neurofilament, NF M

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue
Positive IHC detected inmouse cerebellum tissue, human brain tissue, human colon tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive FC (Intra) detected inPC-12 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25805-1-AP targets NF-M in WB, IHC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, canine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag22709

Product name: Recombinant human NEFM protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-97 aa of BC002421

Sequence: MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSSAESSLDFSQSSSLLNGGSGPGGDYKLS

Predict reactive species
Full Name neurofilament, medium polypeptide
Calculated Molecular Weight 102 kDa
Observed Molecular Weight 140 kDa
GenBank Accession NumberBC002421
Gene Symbol NF-M
Gene ID (NCBI) 4741
RRIDAB_2880245
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP07197
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEFM, also named as NEF3 and NFM, belongs to the intermediate filament family. Neurofilaments are the 10nm intermediate filaments found specifically in neurons. They are a major component of the cell's cytoskeleton, and provide support for normal axonal radial growth. Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. The names given to the three major neurofilament subunits are based upon the apparent molecular weight of the mammalian subunits on SDS-PAGE:NF-L, 65-68 kDa; NF-M,145-160 kDa and NF-H, 200-220 kDa. This antibody recognizes endogenous NF-M protein.

Protocols

Product Specific Protocols
IF protocol for NF-M antibody 25805-1-APDownload protocol
IHC protocol for NF-M antibody 25805-1-APDownload protocol
WB protocol for NF-M antibody 25805-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
canineIF

Theranostics

Implantation of regenerative complexes in traumatic brain injury canine models enhances the reconstruction of neural networks and motor function recovery.

Authors - Jipeng Jiang
mouse,canineIF

Biomater Sci

3D printing collagen/heparin sulfate scaffolds boost neural network reconstruction and motor function recovery after traumatic brain injury in canine.

Authors - Jipeng Jiang
mouseWB

Mol Autism

RNA sequencing and proteomics approaches reveal novel deficits in the cortex of Mecp2-deficient mice, a model for Rett syndrome.

Authors - Natasha L Pacheco
canineIHC

Front Cardiovasc Med

Vagus Nerve Stimulation in Early Stage of Acute Myocardial Infarction Prevent Ventricular Arrhythmias and Cardiac Remodeling.

Authors - Shuang Zhao
ratWB

Neurosci Lett

Overexpression of miR-338-5p in exosomes derived from mesenchymal stromal cells provides neuroprotective effects by the Cnr1/Rap1/Akt pathway after spinal cord injury in rats.

Authors - Anwei Zhang
ratWB

Cell Biol Int

Study of the protective effect on damaged intestinal epithelial cells of rat multilineage-differentiating stress-enduring (Muse) cells.

Authors - Dong Sun
Loading...
||
New chat Able
正在加载,请稍候...