Tested Applications
| Positive WB detected in | rat brain tissue, rat brain, mouse brain tissue, PC-12 cells |
| Positive IHC detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
| Positive IF/ICC detected in | SH-SY5Y cells |
| Positive FC (Intra) detected in | PC-12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:20000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:2000 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66396-1-Ig targets NF-M in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22709 Product name: Recombinant human NEFM protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-97 aa of BC002421 Sequence: MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSSAESSLDFSQSSSLLNGGSGPGGDYKLS Predict reactive species |
| Full Name | neurofilament, medium polypeptide |
| Calculated Molecular Weight | 102 kDa |
| Observed Molecular Weight | 140 kDa |
| GenBank Accession Number | BC002421 |
| Gene Symbol | NF-M |
| Gene ID (NCBI) | 4741 |
| RRID | AB_2881770 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P07197 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
NEFM, also named as NEF3 and NFM, belongs to the intermediate filament family. Neurofilaments are the 10 nm intermediate filaments found specifically in neurons. They are a major component of the cell's cytoskeleton, and provide support for normal axonal radial growth. Neurofilaments usually contain three intermediate filament proteins: L, M, and H which are involved in the maintenance of neuronal caliber. The names given to the three major neurofilament subunits are based upon the apparent molecular weight of the mammalian subunits on SDS-PAGE: NF-L, 65-68 kDa; NF-M,140-160 kDa and NF-H, 200-220 kDa.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for NF-M antibody 66396-1-Ig | Download protocol |
| IF protocol for NF-M antibody 66396-1-Ig | Download protocol |
| IHC protocol for NF-M antibody 66396-1-Ig | Download protocol |
| WB protocol for NF-M antibody 66396-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Reyes (Verified Customer) (10-03-2024) | NF-M in red worked very well marking my neurons (in green) in FFPE tissue and also the axons (neurofilaments).
![]() |




















