Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

NNMT Polyclonal antibody

NNMT Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 15123-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

EC:2.1.1.1, Nicotinamide N-methyltransferase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inL02 cells, HepG2 cells, mouse liver tissue, rat liver tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15123-1-AP targets NNMT in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7197

Product name: Recombinant human NNMT protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-264 aa of BC000234

Sequence: MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Predict reactive species
Full Name nicotinamide N-methyltransferase
Calculated Molecular Weight 30 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC000234
Gene Symbol NNMT
Gene ID (NCBI) 4837
RRIDAB_2153579
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP40261
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NNMT can catalyze the N-methylation of nicotinamide using the universal methyl donor S-adenosyl-L-methionine to form N1-methylnicotinamide and S-adenosyl-L-homocysteine, a predominant nicotinamide/vitamin B3 clearance pathway (PMID: 21823666; 23455543; 8182091). It plays a central role in regulating cellular methylation potential, by consuming S-adenosyl-L-methionine and limiting its availability for other methyltransferases. Actively mediates genome-wide epigenetic and transcriptional changes through hypomethylation of repressive chromatin marks, such as H3K27me3 (PMID: 23455543; PMID: 26571212; PMID: 31043742).

Protocols

Product Specific Protocols
FC protocol for NNMT antibody 15123-1-APDownload protocol
IF protocol for NNMT antibody 15123-1-APDownload protocol
IHC protocol for NNMT antibody 15123-1-APDownload protocol
IP protocol for NNMT antibody 15123-1-APDownload protocol
WB protocol for NNMT antibody 15123-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIHC

Cancer Lett

Liver metastasis or peritoneal metastasis: single-cell RNA sequencing reveals the organotropism in colorectal cancer is driven by distinct partial-EMT processes

Authors - Chengxuan Yu
humanWB,IHC,IF

Cell Rep

Single-cell analysis reveals insights into epithelial abnormalities in ovarian endometriosis

Authors - Jia Yan
humanWB,IHC,IF

Oncogene

Stromal nicotinamide N-methyltransferase orchestrates the crosstalk between fibroblasts and tumour cells in oral squamous cell carcinoma: evidence from patient-derived assembled organoids

Authors - Hui Zhao

Oncogene

NNMT-mediated N6-methyladenosine modification of NR4A3 mRNA facilitates lymphatic metastasis of gastric adenocarcinoma

Authors - Xiaoya Zhao
mouseWB

Mol Metab

Disrupted Liver Oxidative Metabolism in Glycine N-Methyltransferase-Deficient Mice is Mitigated by Dietary Methionine Restriction.

Authors - Ferrol I Rome
humanWB

Mol Oncol

Elevated N-methyltransferase expression induced by hepatic stellate cells contributes to the metastasis of hepatocellular carcinoma via regulation of the CD44v3 isoform.

Authors - Jie Li
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Kenzo (Verified Customer) (01-05-2024)

This antibody worked for immunofluorescence with a little background

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: Mouse brain
FH

Johnny (Verified Customer) (01-07-2022)

products from proteintech have always been reliable.

  • Applications: Western Blot
Loading...
||
New chat

Able

正在加载,请稍候...