Use Able AI chat for product recommendations

Osteocalcin/OCN Polyclonal antibody

Osteocalcin/OCN Polyclonal Antibody for IHC, IF/ICC, FC (Intra), ELISA

Cat No. 23418-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

IHC, IF/ICC, FC (Intra), ELISA

BGLAP, Osteocalcin, BGP, Bone Gla protein, Gamma-carboxyglutamic acid-containing protein

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite®594
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IHC detected inmouse testis tissue, human osteosarcoma tissue, human testis tissue, rat testis tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells, NIH/3T3 cells
Positive FC (Intra) detected inNIH/3T3 cells, U2OS cells

Recommended dilution

ApplicationDilution
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23418-1-AP targets Osteocalcin/OCN in IHC, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, goat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag20065

Product name: Recombinant human Osteocalcin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 24-100 aa of BC113432

Sequence: KPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV

Predict reactive species
Full Name bone gamma-carboxyglutamate (gla) protein
Calculated Molecular Weight 100 aa, 11 kDa
GenBank Accession NumberBC113432
Gene Symbol Osteocalcin
Gene ID (NCBI) 632
RRIDAB_2879275
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP02818
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Osteocalcin is a small, highly conserved molecule associated with mineralization of bone matrix. Osteocalcin is specifically expressed in osteoblasts and is the most abundant non-collagenous protein in bone. It regulates the dynamics of new bone formation and bone resorption by interaction with vitamin D, and by influencing the differentiation of osteoblasts. Osteocalcin is also involved in the posttranslational targeting of vitamin K-dependent gamma-carboxylation, which controls blood coagulation.

Protocols

Product Specific Protocols
FC protocol for Osteocalcin/OCN antibody 23418-1-APDownload protocol
IF protocol for Osteocalcin/OCN antibody 23418-1-APDownload protocol
IHC protocol for Osteocalcin/OCN antibody 23418-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
mouseIHC

Adv Mater

Supramolecular Hydrogel with Ultra-Rapid Cell-Mediated Network Adaptation for Enhancing Cellular Metabolic Energetics and Tissue Regeneration

Authors - Zhuo Li
mouseIF

Bioact Mater

Ultrasound-generated bubbles enhance osteogenic differentiation of mesenchymal stromal cells in composite collagen hydrogels

Authors - Somnath Maji
human

Bioact Mater

3D Printed Biomimetic Metamaterials with Graded Porosity and Tapering Topology for Improved Cell Seeding and Bone Regeneration

Authors - Lei Zhang
mouseIHC,IF

ACS Nano

Nanotopography Sequentially Mediates Human Mesenchymal Stem Cell-Derived Small Extracellular Vesicles for Enhancing Osteogenesis.

Authors - Liang Ma
mouse,goatIF

Nat Commun

Optogenetic activation of mechanical nociceptions to enhance implant osseointegration

Authors - Qijin Wang

Adv Sci (Weinh)

POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling

Authors - Hang Liu

Reviews

    4.2 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


CHAO (Verified Customer) (03-31-2022)

Weak bands around the correct size

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse Heart

LUNFENG (Verified Customer) (01-27-2020)

GOOD

  • Applications: Immunofluorescence,
  • Cell Tissue Type: HEART

Jie (Verified Customer) (01-23-2020)

Not working very well in my western blot

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse kidney tissue

Canzhao (Verified Customer) (01-17-2020)

This antibody worked very well on western blot and immunofluorescence, very specific. I recommend this antibody!

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: 1:1000 for WB, 1:100 for IF
  • Cell Tissue Type: Mouse heart and cultured cardiomyocytes.
Loading...
||
New chat

Able

正在加载,请稍候...