P2RX7 Polyclonal antibody

P2RX7 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 11144-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

P2X7, Purinergic receptor

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, mouse cerebellum tissue
Positive FC (Intra) detected inRAW 264.7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11144-1-AP targets P2RX7 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1600

Product name: Recombinant human P2RX7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 246-595 aa of BC011913

Sequence: AIQGGIMGIEIYWDCNLDRWFHHCHPKYSFRRLDDKTTNVSLYPGYNFRYAKYYKENNVEKRTLIKVFGIRFDILVFGTGGKFDIIQLVVYIGSTLSYFGLAAVFIDFLIDTYSSNCCRSHIYPWCKCCQPCVVNEYYYRKKCESIVEPKPTLKYVSFVDESHIRMVNQQLLGRSLQDVKGQEVPRPAMDFTDLSRLPLALHDTPPIPGQPEEIQLLRKEATPRSRDSPVWCQCGSCLPSQLPESHRCLEELCCRKKPGACITTSELFRKLVLSRHVLQFLLLYQEPLLALDVDSTNSRLRHCAYRCYATWRFGSQDMADFAILPSCCRWRIRKEFPKSEGQYSGFKSPY

Predict reactive species
Full Name purinergic receptor P2X, ligand-gated ion channel, 7
Calculated Molecular Weight 69 kDa
Observed Molecular Weight 70-80 kDa
GenBank Accession NumberBC011913
Gene Symbol P2RX7
Gene ID (NCBI) 5027
RRIDAB_2158371
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99572
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs) (PMID: 21724990). P2RX7 functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. P2RX7 is highly expressed by cells of the haemopoietic lineage and can mediate cell death, killing of infectious organisms, and regulation of the inflammatory response (PMID: 22102807).

Protocols

Product Specific Protocols
WB protocol for P2RX7 antibody 11144-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

J Immunol

The danger signal, extracellular ATP, is a sensor for an airborne allergen and triggers IL-33 release and innate Th2-type responses.

Authors - Kouzaki Hideaki H
mouseWB

Front Cell Neurosci

Clemastine Alleviates Depressive-Like Behavior Through Reversing the Imbalance of Microglia-Related Pro-inflammatory State in Mouse Hippocampus.

Authors - Wen-Jun Su

J Leukoc Biol

HMG-CoA reductase inhibitors activate caspase-1 in human monocytes depending on ATP release and P2X7 activation.

Authors - Liao Yi-Hsiang YH
ratWB,IHC

Environ Toxicol

Astaxanthin Alleviates Lung Injury by Regulating Oxidative Stress, Inflammatory Response, P2X7 Receptor, NF-κB, Bcl-2, and Caspase-3 in LPS-Induced Endotoxemia

Authors - Seckin Ozkanlar
humanIF

J Exp Clin Cancer Res

Shock wave-induced ATP release from osteosarcoma U2OS cells promotes cellular uptake and cytotoxicity of methotrexate.

Authors - Baochang Qi
ratWB,IHC

J Biochem Mol Toxicol

Blockade of P2X7 receptor-mediated purinergic signaling with A438079 protects against LPS-induced liver injury in rats

Authors - Adem Kara
Loading...
||
New chat Able
正在加载,请稍候...