Use Able AI chat for product recommendations

PGP Polyclonal antibody

PGP Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 25081-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Aspartate-based ubiquitous Mg(2+)-dependent phosphatase, AUM, EC:3.1.3.21, EC:3.1.3.48, G3PP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, mouse heart tissue, K-562 cells, SH-SY5Y cells, Y79 cells
Positive IP detected inY79 cells
Positive IHC detected inmouse heart tissue, human skeletal muscle tissue, human tonsillitis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25081-1-AP targets PGP in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18623

Product name: Recombinant human PGP protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-321 aa of BC157035

Sequence: MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNSSKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVASVGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGRFIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG

Predict reactive species
Full Name phosphoglycolate phosphatase
Calculated Molecular Weight 321 aa, 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC157035
Gene Symbol PGP
Gene ID (NCBI) 283871
RRIDAB_2879888
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDA6NDG6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PGP(phosphoglycolate phosphatase) belongs to the HAD-like hydrolase superfamily. It is an essential intermediate in the biosynthetic pathway of cardiolipin and a mitochondrial-specific phospholipid regulating the membrane integrity and activities of the organelle. PGP catalyzes the formation of phosphatidylglycerol from phosphatidylglycerophosphate.

Protocols

Product Specific Protocols
FC protocol for PGP antibody 25081-1-APDownload protocol
IF protocol for PGP antibody 25081-1-APDownload protocol
IHC protocol for PGP antibody 25081-1-APDownload protocol
IP protocol for PGP antibody 25081-1-APDownload protocol
WB protocol for PGP antibody 25081-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Acta Biomater

Systematic evaluation of multifunctional paclitaxel-loaded polymeric mixed micelles as a potential anticancer remedy to overcome multidrug resistance.

Authors - Jiulong Zhang
humanIHC

Front Cell Dev Biol

Predicting Panel of Metabolism and Immune-Related Genes for the Prognosis of Human Ovarian Cancer.

Authors - Lingyun Zhang
humanWB

Chin Med

The inhibitory effect and mechanism of Yi-qi-hua-yu-jie-du decoction on the drug resistance of gastric cancer stem cells based on ABC transporters

Authors - Wenjie Huang
humanWB,IF

J Nanobiotechnology

Combination of polythyleneimine regulating autophagy prodrug and Mdr1 siRNA for tumor multidrug resistance

Authors - Changduo Wang
humanIF

Food Chem Toxicol

Hepatotoxic Assessment in A Microphysiological System: Simulation of the Drug Absorption and Toxic Process After an Overdosed Acetaminophen on Intestinal-liver-on-Chip

Authors - Yue Yu
mouseWB

Nat Chem Biol

Quantitative chemoproteomics reveals dopamine's protective modification of Tau

Authors - Qianwen Wang

Reviews

    4.5 out of 5
Add a review

2 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Kerstin (Verified Customer) (10-11-2024)

nice detection of PGP in HT1080 WT cells compared to KO cells, few unspecific bands

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HT1080
PGP Antibody Western Blot validation (1:5000 dilution) in HT1080 (Cat no:25081-1-AP)

Yu Siong (Verified Customer) (10-13-2019)

3 protein bands at 150 kDa are of rat liver whole tissue lysate.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Rat liver tissue
PGP Antibody Western Blot, validation (1:500 dilution) in Rat liver tissue (Cat no:25081-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...