Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis of HEK-293 using 14608-1-AP
WB result of PKN2 antibody (14608-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PKN2 transfected HEK-293 cells.
WB analysis using 14608-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.
WB analysis of SKOV-3 using 14608-1-AP
SKOV-3 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HeLa using 14608-1-AP
HeLa cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of K-562 using 14608-1-AP
K-562 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of HEK-293 using 14608-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
WB analysis of COLO 320 using 14608-1-AP
COLO 320 cells were subjected to SDS PAGE followed by western blot with 14608-1-AP (PKN2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.
IP experiment of COLO 320 using 14608-1-AP
IP result of anti-PKN2 (IP:14608-1-AP, 4ug; Detection:14608-1-AP 1:1000) with COLO 320 cells lysate 2560 ug.
IHC staining of human stomach using 14608-1-AP
Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human lung cancer using 14608-1-AP
Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 14608-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IHC staining of human colon cancer using 14608-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14608-1-AP (PKN2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
IF Staining of HepG2 using 14608-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PKN2 antibody (14608-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
FC experiment of HepG2 using 14608-1-AP
1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human PKN2 (14608-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

Featured Product
KD/KO Validated

PKN2 Polyclonal antibody

PKN2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 14608-1-AP

Publications(3)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA

Synonyms

EC:2.7.11.13, Pak 2, PAK2, PKN gamma, PRK2

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information
Publications (3)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	A2780 cells, K-562 cells, HeLa cells, HEK-293 cells, COLO 320 cells, SKOV-3 cells, HEK-293T cells
Positive IP detected in	COLO 320 cells
Positive IHC detected in	human colon cancer tissue, human lung cancer tissue, human stomach tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells
Positive FC (Intra) detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:500-1:3000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:250-1:1000
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

WB	See 2 publications below
IHC	See 1 publications below
ChIP	See 1 publications below

Product Information

14608-1-AP targets PKN2 in WB, IHC, IF/ICC, FC (Intra), IP, ChIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity	human
Cited Reactivity	human, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag6164 Product name: Recombinant human PKN2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-60 aa of BC062620 Sequence: MDKKVKPPFIPTIRGREDVSNFDDEFTSEAPILTPPREPRILSEEEQEMFRDFDYIADWC Predict reactive species
Full Name	protein kinase N2
Calculated Molecular Weight	112 kDa
Observed Molecular Weight	130 kDa
GenBank Accession Number	BC062620
Gene Symbol	PKN2
Gene ID (NCBI)	5586
RRID	AB_10638487
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q16513
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
FC protocol for PKN2 antibody 14608-1-AP	Download protocol
IF protocol for PKN2 antibody 14608-1-AP	Download protocol
IHC protocol for PKN2 antibody 14608-1-AP	Download protocol
IP protocol for PKN2 antibody 14608-1-AP	Download protocol
WB protocol for PKN2 antibody 14608-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

Species	Application	Title
human	WB	Cancer Cell Int Upregulation of SNTB1 correlates with poor prognosis and promotes cell growth by negative regulating PKN2 in colorectal cancer Authors - Liya Liu View Article
pig	WB,IHC	Reprod Domest Anim miR-26a inhibits proliferation and promotes apoptosis in porcine immature Sertoli cells by targeting the PAK2 gene. Authors - Maoliang Ran View Article
human	ChIP	Mol Med PKN2 enhances the immunosuppressive activity of polymorphonuclear myeloid-derived suppressor cells in esophageal carcinoma by mediating fatty acid oxidation Authors - Xiao Fu View Article