• Featured Product
  • KD/KO Validated

PKC Epsilon Polyclonal antibody

PKC Epsilon Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

Cat No. 20877-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA

PRKCE, Protein kinase C epsilon type, PKCE, nPKC-epsilon, EC:2.7.11.13

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, SH-SY5Y cells, rat brain tissue
Positive IP detected inSH-SY5Y cells
Positive IHC detected inmouse brain tissue, human thyroid cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue
Positive IF/ICC detected inHeLa cells, U2OS cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

20877-1-AP targets PKC Epsilon in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14976

Product name: Recombinant human PRKCE protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 294-413 aa of BC109033

Sequence: VDARGIAKVLADLGVTPDKITNSGQRRKKLIAGAESPQPASGSSPSEEDRSKSAPTSPCDQEIKELENNIRKALSFDNRGEEHRAASSPDGQLMSPGENGEVRQGQAKRLGLDEFNFIKV

Predict reactive species
Full Name protein kinase C, epsilon
Calculated Molecular Weight 737 aa, 84 kDa
Observed Molecular Weight 84 kDa
GenBank Accession NumberBC109033
Gene Symbol PKC Epsilon
Gene ID (NCBI) 5581
RRIDAB_10697812
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ02156
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PKC Epsilon (Protein kinase C epsilon type) is also named as PKC-ε, PRKCE and PKCE. It belongs to the protein kinase superfamily, AGC Ser/Thr protein kinase family and PKC subfamily. PKC-ε, one of the novel isoforms, as a critical player in membrane mobilization during phagocytosis (PMID: 9069266). KC-ε is tethered to the Golgi through binding of its pseudosubstrate domain to phosphatidylinositol-4-phosphate (PI4P) (PMID: 28539432). PKC-ε traffics on microtubule-associated vesicles from the Golgi to the forming phagosome. As the majority of macrophage PKC-ε is cytosolic, and PKCs translocate from the cytosol to their sites of activity, it predicted that cytosolic PKC-ε concentrated at phagosomes to facilitate membrane addition (PMID: 34622926). Two PKC isozymes of the novel group, PKCε and PKCδ, have different and sometimes opposite effects. PKCε stimulates cell growth and differentiation while PKCδ is apoptotic (PMID: 21810427).

Protocols

Product Specific Protocols
WB protocol for PKC Epsilon antibody 20877-1-APDownload protocol
IHC protocol for PKC Epsilon antibody 20877-1-APDownload protocol
IF protocol for PKC Epsilon antibody 20877-1-APDownload protocol
IP protocol for PKC Epsilon antibody 20877-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Elife

cAMP-EPAC-PKCε-RIM1α signaling regulates presynaptic long-term potentiation and motor learning

Authors - Xin-Tai Wang
mouseWB

Biochem Pharmacol

Thromboxane A2-TP axis promotes adipose tissue macrophages M1 polarization leading to insulin resistance in obesity

Authors - Ruijie Xu
mouseWB

J Cell Mol Med

Protein kinase C is involved in the neuroprotective effect of berberine against intrastriatal injection of quinolinic acid-induced biochemical alteration in mice.

Authors - Peng Liu
WB

Fish Shellfish Immunol

In vivo study of a novel protein kinase C that mediates immunocompetence and catecholamine biosynthesis in hemocytes of Litopenaeus vannamei by using its potential competitive inhibitor, bisindolylmaleimide I.

Authors - Zhong-Wen Chang
humanWB

Mol Biol Cell

MiR-34a regulates blood-tumor barrier function by targeting protein kinase Cɛ.

Authors - Wei Zhao
humanWB

Oxid Med Cell Longev

p66Shc Mediates Mitochondrial Dysfunction Dependent on PKC Activation in Airway Epithelial Cells Induced by Cigarette Smoke.

Authors - Ming Zhang
Loading...
||
New chat Able
正在加载,请稍候...