Featured Product
KD/KO Validated

PSAT1 Polyclonal antibody

PSAT1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10501-1-AP

Publications (114)

Review Product

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA
For FC, select conjugated version.

Synonyms

EC:2.6.1.52, EPIP, Phosphoserine aminotransferase, PSA, PSAT

Formulation: PBS, Azide, Glycerol

PBS, Azide, Glycerol

Conjugate: Unconjugated

Unconjugated

CoraLite® Plus 488

Size/Concentration:

SKU:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Filter: AllWBIPIHCIF/ICCFC (Intra)

WB analysis using 10501-1-AP
Various lysates were subjected to SDS PAGE followed by western blot with 10501-1-AP (PSAT1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 10501-1-AP
WB result of PSAT1 antibody (10501-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PSAT1 transfected HEK-293 cells.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of HEK-293 using 10501-1-AP
HEK-293 cells were subjected to SDS PAGE followed by western blot with 10501-1-AP (PSAT1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
WB analysis of Jurkat using 10501-1-AP
Jurkat cells were subjected to SDS PAGE followed by western blot with 10501-1-AP (PSAT1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IP experiment of HeLa using 10501-1-AP
IP result of anti-PSAT1 (IP:10501-1-AP, 3ug; Detection:10501-1-AP 1:300) with HeLa cells lysate 2480ug.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human pancreas cancer using 10501-1-AP
Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 10501-1-AP (PSAT1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 10501-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10501-1-AP (PSAT1 Antibody) at dilution of 1:50 (under 10x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IHC staining of human colon cancer using 10501-1-AP
Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10501-1-AP (PSAT1 Antibody) at dilution of 1:50 (under 40x lens).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 10501-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PSAT1 antibody (10501-1-AP) at dilution of 1:400 and CoraLite®594-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-4).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
IF Staining of HepG2 using 10501-1-AP
Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PSAT1 antibody (10501-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-Phalloidin (red).
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
FC experiment of HepG2 using 10501-1-AP
1x10^6 HepG2 cells were intracellularly stained with 0.25 ug PSAT1 Polyclonal antibody (10501-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.
This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PSAT1 in ?

Overview

Tested Applications
Product Information
Publications (114)
Protocols

Print datasheet

MSDS SDS

Tested Applications

Positive WB detected in	HeLa cells, Jurkat cells, HEK-293 cells, HepG2 cells, K-562 cells, rat brain tissue
Positive IP detected in	HeLa cells
Positive IHC detected in	human pancreas cancer tissue, human colon cancer tissue **Note: suggested antigen retrieval with TE buffer pH 9.0; () Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0***
Positive IF/ICC detected in	HepG2 cells
Positive FC (Intra) detected in	HepG2 cells

Recommended dilution

Application	Dilution
Western Blot (WB)	WB : 1:5000-1:50000
Immunoprecipitation (IP)	IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)	IHC : 1:200-1:800
Immunofluorescence (IF)/ICC	IF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)	FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10501-1-AP targets PSAT1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity	human, rat
Cited Reactivity	human, mouse, pig
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag0776 Product name: Recombinant human PSAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-370 aa of BC004863 Sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL Predict reactive species
Full Name	phosphoserine aminotransferase 1
Calculated Molecular Weight	40 kDa
Observed Molecular Weight	37-40 kDa
GenBank Accession Number	BC004863
Gene Symbol	PSAT1
Gene ID (NCBI)	29968
RRID	AB_2172597
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q9Y617
Storage Buffer	PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions	Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSAT1, also named PSA and PSAT, belongs to the class-V pyridoxal-phosphate-dependent aminotransferase family and SerC subfamily. It catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine. PSAT1 represents a new interesting target for CRC therapy. (PMID:18221502) It may be implicated in altered serine metabolism and schizophrenia spectrum conditions. (PMID:20955740)

Protocols

Product Specific Protocols
FC protocol for PSAT1 antibody 10501-1-AP	Download protocol
IF protocol for PSAT1 antibody 10501-1-AP	Download protocol
IHC protocol for PSAT1 antibody 10501-1-AP	Download protocol
IP protocol for PSAT1 antibody 10501-1-AP	Download protocol
WB protocol for PSAT1 antibody 10501-1-AP	Download protocol

Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-PSAT1 antibody (Cat# 10501-1-AP) has 114 citations across high-impact journals including Nature, Cell Metabolism, Nature Communications, Nature Immunology, Nature Chemical Biology, Cell Research, Cancer Research, Journal of Clinical Investigation, and Science Advances. Key research fields include serine synthesis pathway, metabolic reprogramming in cancer (lung, breast, ovarian, colorectal, prostate, renal), stem cell biology, immune metabolism, ferroptosis, glutamine metabolism, and one-carbon metabolism.

Species	Application	Title
human	WB	Nature Stem cell function and stress response are controlled by protein synthesis. Authors - Sandra Blanco View Article
human	WB	Cell Metab Serine metabolism antagonizes antiviral innate immunity by preventing ATP6V0d2-mediated YAP lysosomal degradation. Authors - Long Shen View Article
mouse	WB	Cell Metab PMID: 28111214 Authors - Eric H Ma View Article
mouse	WB	Cell Metab The integrated stress response fine-tunes stem cell fate decisions upon serine deprivation and tissue injury Authors - Jesse S S Novak View Article
human	WB	Cell Res cMyc-mediated activation of serine biosynthesis pathway is critical for cancer progression under nutrient deprivation conditions. Authors - Linchong Sun View Article
mouse,human	WB	Cancer Commun (Lond) Unfolded protein response kinase PERK supports survival and metastasis of circulating tumor cell clusters via SAM synthesis and H3K4me3-dependent PDGFB signaling. Authors - Rui Tang View Article