• Featured Product
  • KD/KO Validated

PSMD9 Polyclonal antibody

PSMD9 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 26922-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

26S proteasome non-ATPase regulatory subunit 9, p27, Rpn4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, MCF-7 cells, MDA-MB-453s cells, HepG2 cells, Jurkat cells, mouse spleen tissue
Positive IP detected inA549 cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU2OS cells, A549 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26922-1-AP targets PSMD9 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag25638

Product name: Recombinant human PSMD9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-102 aa of BC004213

Sequence: MSDEEARQSGGSSQAGVVTVSDVQELMRRKEEIEAQIKANYDVLESQKGIGMNEPLVDCEGYPRSDVDLYQVRTARHNIICLQNDHKAVMKQVEEALHQLHA

Predict reactive species
Full Name proteasome (prosome, macropain) 26S subunit, non-ATPase, 9
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 25-30 kDa
GenBank Accession NumberBC004213
Gene Symbol PSMD9
Gene ID (NCBI) 5715
RRIDAB_2880687
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO00233
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PSMD9 is a ubiquitous protein of eukaryotic cells and is a chaperon of the 26S proteasome complex, which degrades ubiquitinated proteins in eukaryotic cells and contributes to the degradation of intracellular proteins into antigenic peptides for antigen presentation by MHC class I cells. The 26S mammalian base sub-complex involves three distinct modules which have ATPase subunits distinctly associated to three chaperones, one of which is PSMD9 regulating the modules assembly. The PSMD9 ubiquitous regulatory role within the proteasome implies its potential pleiotropic effects within different physio-pathological systems. PSMD9 is known to form a stable subcomplex with PSMC3 and PSMC6, two of the AAA-ATPases, assisting in the assembly of the 20S and 19S particles to form the holo complex.

Protocols

Product Specific Protocols
FC protocol for PSMD9 antibody 26922-1-APDownload protocol
IF protocol for PSMD9 antibody 26922-1-APDownload protocol
IHC protocol for PSMD9 antibody 26922-1-APDownload protocol
IP protocol for PSMD9 antibody 26922-1-APDownload protocol
WB protocol for PSMD9 antibody 26922-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Tanel (Verified Customer) (01-02-2026)

Both antibodies work great in WB and IF. Single band in A549 and H1299 cells, for WB one could dilute even more up to 1:2000. In IF, there is nuclear and cytoplasmic distribution.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 for WB and IF
  • Cell Tissue Type: A549 and H1299
Loading...
||
New chat

Able

正在加载,请稍候...