×
Use Able AI chat for product recommendations

SCAMP2 Polyclonal antibody

SCAMP2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15119-1-AP
Publications(2)

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Secretory carrier-associated membrane protein 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Please visit your regions distributor:

Filter:
  • Western Blot (WB) analysis of HepG2 cells using SCAMP2 Polyclonal antibody (15119-1-AP)

    WB analysis of HepG2 using 15119-1-AP

    HepG2 cells were subjected to SDS PAGE followed by western blot with 15119-1-AP (SCAMP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of mouse lung tissue using SCAMP2 Polyclonal antibody (15119-1-AP)

    WB analysis of mouse lung using 15119-1-AP

    mouse lung tissue were subjected to SDS PAGE followed by western blot with 15119-1-AP (SCAMP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of HeLa cells using SCAMP2 Polyclonal antibody (15119-1-AP)

    WB analysis of HeLa using 15119-1-AP

    HeLa cells were subjected to SDS PAGE followed by western blot with 15119-1-AP (SCAMP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Western Blot (WB) analysis of human liver tissue using SCAMP2 Polyclonal antibody (15119-1-AP)

    WB analysis of human liver using 15119-1-AP

    human liver tissue were subjected to SDS PAGE followed by western blot with 15119-1-AP (SCAMP2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunoprecipitation (IP) experiment of HepG2 cells using SCAMP2 Polyclonal antibody (15119-1-AP)

    IP experiment of HepG2 using 15119-1-AP

    IP result of anti-SCAMP2 (IP:15119-1-AP, 4ug; Detection:15119-1-AP 1:500) with HepG2 cells lysate 3300 ug.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human pancreas cancer tissue using SCAMP2 Polyclonal antibody (15119-1-AP)

    IHC staining of human pancreas cancer using 15119-1-AP

    Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 15119-1-AP (SCAMP2 antibody) at dilution of 1:100 (under 10x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunohistochemistry (IHC) staining of human pancreas cancer tissue using SCAMP2 Polyclonal antibody (15119-1-AP)

    IHC staining of human pancreas cancer using 15119-1-AP

    Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 15119-1-AP (SCAMP2 antibody) at dilution of 1:100 (under 40x lens).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Immunofluorescence (IF) / fluorescent staining of HEK-293 cells using SCAMP2 Polyclonal antibody (15119-1-AP)

    IF Staining of HEK-293 using 15119-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HEK-293 cells using SCAMP2 antibody (15119-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
  • Flow cytometry (FC) experiment of HEK-293 cells using SCAMP2 Polyclonal antibody (15119-1-AP)

    FC experiment of HEK-293 using 15119-1-AP

    1x10^6 HEK-293 cells were intracellularly stained with 0.4 ug SCAMP2 Polyclonal antibody (15119-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

    This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, human liver tissue, mouse lung tissue
Positive IP detected inHepG2 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15119-1-AP targets SCAMP2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7190

Product name: Recombinant human SCAMP2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-152 aa of BC001376

Sequence: MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKML

Predict reactive species
Full Name secretory carrier membrane protein 2
Calculated Molecular Weight 37 kDa
Observed Molecular Weight 39 kDa
GenBank Accession NumberBC001376
Gene Symbol SCAMP2
Gene ID (NCBI) 10066
RRIDAB_2184772
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15127
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SCAMP2 functions in post-Golgi recycling pathways. It acts as a recycling carrier to the cell surface. It couples Arf6-stimulated PLD activity to exocytosis and links this process to formation of fusion pores. SCAMP2 is marker for secretory vesicles and tobacco BY-2 cells as a model system. The MW of SCAMP2 is 36-39 kDa with modification.

Protocols

Product Specific Protocols
FC protocol for SCAMP2 antibody 15119-1-APDownload protocol
IF protocol for SCAMP2 antibody 15119-1-APDownload protocol
IHC protocol for SCAMP2 antibody 15119-1-APDownload protocol
IP protocol for SCAMP2 antibody 15119-1-APDownload protocol
WB protocol for SCAMP2 antibody 15119-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Aging (Albany NY)

Expression and prognostic analyses of SCAMPs in pancreatic adenocarcinoma.

Authors - Feiyu Mao
View Article
humanWB,IHC

Front Immunol

Identification of SCAMP2 as a regulator of NOTCH signaling in cisplatin resistance through a novel prognostic model for bladder cancer

Authors - Longjun Cai
View Article
||
New chat

Able™

正在加载，请稍候...