Tested Applications
| Positive WB detected in | A549 cells, Jurkat cells, L02 cells |
| Positive IHC detected in | human kidney tissue, human liver cancer tissue, mouse liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 3 publications below |
| IF | See 2 publications below |
Product Information
20857-1-AP targets SLC38A4 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14827 Product name: Recombinant human SLC38A4 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-77 aa of BC101827 Sequence: MDPMELRNVNIEPDDESSSGESAPDSYIGIGNSEKAAMSSQFANEDTESQKFLTNGFLGKKKLADYADEHHPGTTSF Predict reactive species |
| Full Name | solute carrier family 38, member 4 |
| Calculated Molecular Weight | 547 aa, 61 kDa |
| Observed Molecular Weight | 61 kDa |
| GenBank Accession Number | BC101827 |
| Gene Symbol | SLC38A4 |
| Gene ID (NCBI) | 55089 |
| RRID | AB_10696186 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q969I6 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for SLC38A4 antibody 20857-1-AP | Download protocol |
| WB protocol for SLC38A4 antibody 20857-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Clin Transl Med Melatonin inhibits lipid accumulation to repress prostate cancer progression by mediating the epigenetic modification of CES1. | ||
Pathol Res Pract Assisted reproductive technology causes reduced expression of amino acid transporters in human full-term placentas | ||
J Clin Invest Arteriovenous metabolomics in pigs reveals CFTR regulation ofmetabolism inmultiple organs |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Christopher (Verified Customer) (06-13-2024) | EXCELLENT ANTIBODY! I had very clean bands using a 1:1000 dilution with the recommended blocking buffers.
|

















