• Featured Product
  • KD/KO Validated

Spartin/SPG20 Polyclonal antibody

Spartin/SPG20 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 13791-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

SPG20, KIAA0610, SPART, Spartin, SPG 20

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, PANC-1 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman liver cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13791-1-AP targets Spartin/SPG20 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4815

Product name: Recombinant human Spartin, SPG20 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC047083

Sequence: MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISISSKESEHTGTGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPKDMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAEGHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVSAPSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQI

Predict reactive species
Full Name spastic paraplegia 20 (Troyer syndrome)
Calculated Molecular Weight 72 kDa
Observed Molecular Weight 75-84 kDa
GenBank Accession NumberBC047083
Gene Symbol Spartin
Gene ID (NCBI) 23111
RRIDAB_2195683
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ8N0X7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SPG20 (spastic paraplegia 20) gene encodes a multifunctional Spartin protein. SPG20 protein is highly expressed in adipose tissue and may be implicated in endosomal trafficking and microtubule dynamics. SPG20 is mutated in Troyer syndrome, a hereditary spastic paraplegia defined by degeneration of upper motor neurons, recent study showed that regulation of SPG20 on mitochondrial calcium homeostasis may contribute to the pathophysiology of Troyer syndrome. Hypermethylation of SPG20 promoter, found in colorectal cancer patients, may play a role in cytokinesis arrest in colorectal tumorigenesis.

Protocols

Product Specific Protocols
FC protocol for Spartin/SPG20 antibody 13791-1-APDownload protocol
IHC protocol for Spartin/SPG20 antibody 13791-1-APDownload protocol
IP protocol for Spartin/SPG20 antibody 13791-1-APDownload protocol
WB protocol for Spartin/SPG20 antibody 13791-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Ann Neurol

Developmental and degenerative features in a complicated spastic paraplegia.

Authors - Manzini M Chiara MC
humanWB

Elife

Chromosome mis-segregation and cytokinesis failure in trisomic human cells.

Authors - Joshua M Nicholson
mouseWB,IF

Hum Mol Genet

Spg20-/- mice reveal multimodal functions for Troyer syndrome protein spartin in lipid droplet maintenance, cytokinesis and BMP signaling.

Authors - Renvoisé Beno?t B
  • KO Validated
humanWB,IF

Oncogene

SPG20, a novel biomarker for early detection of colorectal cancer, encodes a regulator of cytokinesis.

Authors - Lind G E GE
mouseWB

J Cell Sci

Germline Deletion of Huntingtin Causes Male Infertility and Arrested Spermiogenesis in Mice.

Authors - Jinting Yan
humanWB,IF

FASEB J

A novel mutation in SPART gene causes a severe neurodevelopmental delay due to mitochondrial dysfunction with complex I impairments and altered pyruvate metabolism.

Authors - Chiara Diquigiovanni
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

beyenech (Verified Customer) (11-22-2019)

The antibody works also for Immunoprecipitation

  • Applications: Western Blot, Immunofluorescence,
  • Primary Antibody Dilution: IF: 1:100; WB:1:1000
  • Cell Tissue Type: 293T and HeLa
Spartin/SPG20 Antibody Western Blot,Immunofluorescence, validation (IF: 1:100; WB:1:1000 dilution) in 293T and HeLa (Cat no:13791-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...