Use Able AI chat for product recommendations

SUPT6H Polyclonal antibody

SUPT6H Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 23073-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

emb 5, Histone chaperone suppressor of Ty6, hSPT6, KIAA0162, SPT6

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, Jurkat cells
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

23073-1-AP targets SUPT6H in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19426

Product name: Recombinant human SUPT6H protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1618-1726 aa of BC136524

Sequence: TPSYSYTTPSQPITTPQYHQLQASTTPQSAQAQPQPSSSSRQRQQQPKSNSHAAIDWGKMAEQWLQEKEAERRKQKQRLTPRPSPSPMIESTPMSIAGDATPLLDEMDR

Predict reactive species
Full Name suppressor of Ty 6 homolog (S. cerevisiae)
Calculated Molecular Weight 1726 aa, 199 kDa
Observed Molecular Weight 230 kDa
GenBank Accession NumberBC136524
Gene Symbol SUPT6H
Gene ID (NCBI) 6830
RRIDAB_11232593
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ7KZ85
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SUPT6H (suppressor of Ty6 homolog), also known as SPT6, SPT6H, Tat-CT2 (Tat-cotransactivator 2 protein) or emb-5 in C. elegans, is a 1,726 amino acid protein that is highly conserved from yeast to humans. Expressed ubiquitously, SUPT6H localizes to the nucleus and contains one SH2 domain and one S1 domain. SUPT6H participates in both DRB (5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole)-mediated transcriptional inhibition as well as the enhancement of transcriptional elongation by the RNA polymerase II (Pol II). SUPT6H interacts with the nuclear proteins SPT4 and SPT5, which comprise the DSIF (DRB-sensitivity-inducing factor) complex that binds RNA polymerase II, and directly regulates elongation. Via its C-terminus, SUPT6H can also interact with Histone H3. Due to alternative splicing events, three isoforms exist for SUPT6H. This antibody specifically recognizes the 230kd phosphorylated SUPT6H protein.

Protocols

Product Specific Protocols
IHC protocol for SUPT6H antibody 23073-1-APDownload protocol
IP protocol for SUPT6H antibody 23073-1-APDownload protocol
WB protocol for SUPT6H antibody 23073-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle

Adv Sci (Weinh)

H3K36me3-Guided m6A Modification of Oncogenic L1CAM-AS1 Drives Macrophage Polarization and Immunotherapy Resistance in Hepatocellular Carcinoma

Authors - Teng Wang
humanWB,IP

Nat Commun

TASOR epigenetic repressor cooperates with a CNOT1 RNA degradation pathway to repress HIV.

Authors - Roy Matkovic
humanWB

Cell Rep

SPT6 regulates H3K14Ac deposition in mouse embryonic stem cells

Authors - Daixuan Zhang

Reviews

    5.0 out of 5
Add a review

4 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Lucas (Verified Customer) (04-15-2025)

Works really well in IP and Western Blot

  • Applications: Western Blot, Immunoprecipitation

Roy (Verified Customer) (06-12-2024)

The antibody detects SUPT6H from HeLa and Jurkat cells by WB (1/1000 dilution - Overnight incubation at 4°C).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa/Jurkat

Fabienne (Verified Customer) (06-07-2024)

Works very well in IP and Western blot

  • Applications: Western Blot, Immunoprecipitation

Mrinmoyee (Verified Customer) (09-21-2018)

  • Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation,
  • Primary Antibody Dilution: WB: 1:1000, IHC: 1:100, IF: 1:100, IP: 4ug
  • Cell Tissue Type: Cancer cells and tissues
SUPT6H Antibody Western Blot,Immunohistochemistry,Immunofluorescence,Immunoprecipitation, validation (WB: 1:1000, IHC: 1:100, IF: 1:100, IP: 4ug dilution) in Cancer cells and tissues (Cat no:23073-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...