Tested Applications
| Positive WB detected in | Daudi cells, Raji cells, Ramos cells |
| Positive IHC detected in | human liver cancer tissue, human appendicitis tissue, human spleen tissue, human kidney tissue, human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | Ramos cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| Immunohistochemistry (IHC) | IHC : 1:400-1:1600 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
14858-1-AP targets SYK in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag6657 Product name: Recombinant human SYK protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 368-635 aa of BC001645 Sequence: KLLTLEDKELGSGNFGTVKKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWTYDVENRPGFAAVELRLRNYYYDVVN Predict reactive species |
| Full Name | spleen tyrosine kinase |
| Calculated Molecular Weight | 72 kDa |
| Observed Molecular Weight | 66-72 kDa |
| GenBank Accession Number | BC001645 |
| Gene Symbol | SYK |
| Gene ID (NCBI) | 6850 |
| ENSEMBL Gene ID | ENSG00000165025 |
| RRID | AB_2878086 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P43405 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SYK belongs to the protein kinase superfamily, Tyr protein kinase family and SYK/ZAP-70 subfamily. It is positive effector of BCR-stimulated responses. SYK couples the B-cell antigen receptor (BCR) to the mobilization of calcium ion either through a phosphoinositide 3-kinase-dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C-gamma-dependent pathway It phosphorylates USP25 and regulates its intracellular levels. SYK also promotes liver fibrosis by activation of hepatic stellate cells and acts as a biomarker for human hepatocellular carcinoma. (PMID: 29537660) SYK can be detected 66-72 kDa in human and mouse (PMID: 37661351).
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SYK antibody 14858-1-AP | Download protocol |
| IHC protocol for SYK antibody 14858-1-AP | Download protocol |
| WB protocol for SYK antibody 14858-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SYK Polyclonal antibody (Cat# 14858-1-AP) has 16 citations published in journals including Theranostics, Int J Biol Macromol, Antioxidants, Environ Res, J Ethnopharmacol, Food Funct, Int Immunopharmacol, Neurotoxicol Teratol, J Diabetes Investig, Front Neurol, Brain Res, Animals, Front Genet, Fitoterapia, Res Vet Sci, and Environ Health. Research fields span tumor immunity, neuroinflammation, macrophage polarization, diabetic kidney injury, stroke, allergy, constipation, liver injury, glioma, and pulmonary toxicity.
| Species | Application | Title |
|---|---|---|
Theranostics A novel whole cancer cell vaccine based on modified β-glucan elicits robust anti-tumor immunity. | ||
Int J Biol Macromol A nanobody-enzyme fusion protein targeting PD-L1 and sialic acid exerts anti-tumor effects by C-type lectin pathway-mediated tumor associated macrophages repolarizing | ||
Antioxidants (Basel) Neuron-Derived Sema3B Facilitates Microglial Hematoma Clearance After Intracerebral Hemorrhage. | ||
Environ Res Effects of PFOA and emerging alternatives at environmental concentrations on murine- and human-derived microglia: A comparative study. | ||
J Ethnopharmacol Yiqi Kaimi prescription regulates protein phosphorylation to promote intestinal motility in slow transit constipation | ||
Food Funct Synergistic effects of L-theanine and epigallocatechin gallate in alleviating ovalbumin allergy by regulating intestinal immunity through inhibition of mast cell degranulation |
