• Featured Product
  • KD/KO Validated

TMEM173/STING Polyclonal antibody

The TMEM173/STING polyclonal antibody (19851-1-AP) is one of the most highly cited TMEM173/STING antibodies in the market. It is suitable for WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, ELISA and has been referenced in over 494 publications.
Cat No. 19851-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, CoIP, ELISA, Blocking assay

STING, Endoplasmic reticulum interferon stimulator, ERIS, MITA, MPYS

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHL-60 cells, HEK-293 cells, HepG2 cells, mouse kidney tissue, mouse spleen tissue, Raji cells, THP-1 cells, HT-29 cells, mouse thymus tissue, C2C12 cells, RAW 264.7 cells, mouse testis tissue
Positive IP detected inmouse spleen tissue
Positive IHC detected inhuman tonsillitis tissue, rat thymus tissue, mouse thymus tissue, human spleen tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman tonsillitis tissue
Positive IF-Fro detected inmouse brain tissue
Positive IF/ICC detected inHT-29 cells, human tonsillitis tissue, THP-1 cells
Positive FC (Intra) detected inTHP-1 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:20000-1:100000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:8000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19851-1-AP targets TMEM173/STING in WB, IHC, IF/ICC, IF-P, IF-Fro, FC (Intra), IP, CoIP, ELISA, Blocking assay applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, bovine, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13921

Product name: Recombinant human TMEM173 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 174-379 aa of BC047779

Sequence: ELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDFS

Predict reactive species
Full Name transmembrane protein 173
Calculated Molecular Weight 379 aa, 42 kDa
Observed Molecular Weight 35-40 kDa, 80 kDa
GenBank Accession NumberBC047779
Gene Symbol STING
Gene ID (NCBI) 340061
RRIDAB_10665370
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ86WV6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Stimulator of interferon genes (STING, also known as ERIS, MITA and MPYS, and encoded by TMEM173) is a transmembrane adaptor protein that facilitates innate immune signaling (PMID: 18724357). STING is widely expressed in various cell types such as endothelial cells, epithelial cells, T cells, macrophages, and dendritic cells (PMID: 26603901). It is predominantly located in the endoplasmic reticulum (ER). STING functions as a sensor of cytosolic DNA and promotes the production of type I interferons and pro-inflammatory cytokines. STING is a 379 amino acid protein with a calculated molecular weight of 42 kDa. It has been observed at 35-40 kDa (PMID: 27324217; 29632140; 30918080), and 70-80 kDa corresponding to the expected size of a STING dimer (PMID: 25790474; 29491158).

Protocols

Product Specific Protocols
FC protocol for TMEM173/STING antibody 19851-1-APDownload protocol
IF protocol for TMEM173/STING antibody 19851-1-APDownload protocol
IHC protocol for TMEM173/STING antibody 19851-1-APDownload protocol
IP protocol for TMEM173/STING antibody 19851-1-APDownload protocol
WB protocol for TMEM173/STING antibody 19851-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Cell

The WDR11 complex is a receptor for acidic-cluster-containing cargo proteins

Authors - Huaqing Deng
mouseIF

Nature

Tonic prime-boost of STING signalling mediates Niemann-Pick disease type C.

Authors - Ting-Ting Chu
  • KO Validated
mouseWB

Nature

eccDNAs are apoptotic products with high innate immunostimulatory activity

Authors - Yuangao Wang
  • KO Validated
humanWB

Science

The heme-regulated inhibitor is a cytosolic sensor of protein misfolding that controls innate immune signaling.

Authors - Mena Abdel-Nour
humanWB,IF

Signal Transduct Target Ther

TRAF3 activates STING-mediated suppression of EV-A71 and target of viral evasion

Authors - Wenwen Zheng
  • KD Validated
humanWB

Cancer Cell

Mutant p53 suppresses innate immune signaling to promote tumorigenesis.

Authors - Monisankar Ghosh
  • KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Prianka (Verified Customer) (01-31-2025)

This antibody used to work great with a single band at the correct MW, however since receiving a new vial from a different lot, the antibody no longer works. W

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
FH

Hannah (Verified Customer) (12-10-2024)

Superb ab for western blot, detects single strong band ~37kDa that is reduced with knockdown

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/2,000
  • Cell Tissue Type: human fibroblasts
TMEM173/STING Antibody Western Blot validation (1/2,000 dilution) in human fibroblasts (Cat no:19851-1-AP)
FH

Will (Verified Customer) (04-25-2019)

good antibody, will order again

  • Applications: Western Blot,
Loading...
||
New chat

Able

正在加载,请稍候...