• Featured Product
  • KD/KO Validated

TRPM5 Polyclonal antibody

TRPM5 Polyclonal Antibody for WB, IHC, IF, FC (Intra), ELISA

Cat No. 18027-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

LTrpC 5, LTrpC5, LTrpC-5, MLSN1- and TRP-related gene 1 protein, MTR1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue
Positive IHC detected inhuman small intestine tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF detected inmouse olfactory epithelium tissue
Positive FC (Intra) detected inLNCaP cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)IF : 1:50-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

18027-1-AP targets TRPM5 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag12593

Product name: Recombinant human TRPM5 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-350 aa of BC093787

Sequence: MQDVQGPRPGSPGDAEDRRELGLHRGEVNFGGSGKKRGKFVRVPSGVAPSVLFDLLLAEWHLPAPNLVVSLVGEEQPFAMKSWLRDVLRKGLVKAAQSTGAWILTSALRVGLARHVGQAVRDHSLASTSTKVRVVAVGMASLGRVLHRRILEEAQEDFPVHYPEDDGGSQGPLCSLDSNLSHFILVEPGPPGKGDGLTELRLRLEKHISEQRAGYGGTGSIEIPVLCLLVNGDPNTLERISRAVEQAAPWLILAGSGGIADVLAALVNQPHLLVPKVAEKQFKEKFPSKHFSWEDIVRWTKLLQNITSHQHLLTVYDFEQEGSEELDTVILKALVKACKSHSQEPQDYLD

Predict reactive species
Full Name transient receptor potential cation channel, subfamily M, member 5
Calculated Molecular Weight98 kDa, 131 kDa
Observed Molecular Weight 98 kDa
GenBank Accession NumberBC093787
Gene Symbol TRPM5
Gene ID (NCBI) 29850
RRIDAB_2287825
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NZQ8
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Transient receptor potential (TRP) proteins are a diverse family of proteins with structural features typical of ion channels (PMID: 14634208). TRPM5 is a member of the TRPM (melastatin-like) subfamily which are Ca(2+)-permeable cation channels localized predominantly to the plasma membrane (PMID: 11864597). TRPM5 plays a central role in taste transduction (PMID: 17610722). TRPM5 is implicated in enhancing TRPA1 expression and may be involved in regulating insulin secretion (PMID: 21932052). Alternative splicing results in transcript variants encoding distinct isoforms with calculated molecular weights of 98 kDa or 131 kDa. It has been reported that TRPM5 is N-linked glycosylated at a unique site and TRPM5 glycosylation seems not to be involved in channel trafficking, but mainly in its functional regulation (PMID: 24605085).

Protocols

Product Specific Protocols
FC protocol for TRPM5 antibody 18027-1-APDownload protocol
IHC protocol for TRPM5 antibody 18027-1-APDownload protocol
WB protocol for TRPM5 antibody 18027-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Immunity

Intestinal Tuft-2 cells exert antimicrobial immunity via sensing bacterial metabolite N-undecanoylglycine.

Authors - Zhen Xiong
human

Food Funct

Piperine, as a TAS2R14 agonist, stimulates the secretion of glucagon-like peptide-1 in the human enteroendocrine cell line Caco-2.

Authors - Ting-Ting Huang
  • KD Validated
ratIF

Appetite

Chronic exposure to liquid sucrose and dry sucrose diet have differential effects on peripheral taste responses in female rats.

Authors - Lynnette Phillips McCluskey
humanIF

Heliyon

Involvement of pore helix in voltage-dependent inactivation of TRPM5 channel.

Authors - Kunitoshi Uchida

Immunity

Cross-species analyses of thymic mimetic cells reveal evolutionarily ancient origins and both conserved and species-specific elements

Authors - Brooke D Huisman
IF

Front Cell Dev Biol

Generation and functional characterization of tuft cells in non-human primate pancreatic ducts through organoid culture systems

Authors - Kosuke Sakaguchi
Loading...
||
New chat

Able

正在加载,请稍候...