Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

TTK Polyclonal antibody

TTK Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10381-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

EC:2.7.12.1, ESK, hMPS1, Mps 1, MPS1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inDU 145 cells, HEK-293 cells, MCF-7 cells, HeLa cells
Positive IP detected inDU 145 cells
Positive IHC detected inhuman breast cancer tissue, human kidney tissue, human liver cancer tissue, human testis tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10381-1-AP targets TTK in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0405

Product name: Recombinant human TTK protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 533-786 aa of BC000633

Sequence: SGGSSKVFQVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYMVMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGMLKLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSLGCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRISIPELL

Predict reactive species
Full Name TTK protein kinase
Calculated Molecular Weight 97 kDa
Observed Molecular Weight 96-97 kDa
GenBank Accession NumberBC000633
Gene Symbol TTK
Gene ID (NCBI) 7272
RRIDAB_2211979
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP33981
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Mps1 family of kinases colocalizes with mitotic checkpoint proteins in kinetochores and/or spindle pole bodies/centrosomes. TTK has been shown to be a cell cycle-regulated kinase displaying maximum activity during M phase(PMID:15618221). Its kinase activity is required for proper chromosome segregation during mitosis through its involvements in microtubule-chromosome attachment error correction and the mitotic checkpoint(PMID:20937696). TTK mRNA is present at relatively high levels in testis and thymus, tissues which contain a large number of proliferating cells, but is not detected in most other benign tissues (PMID:1639825). It has 2 isoforms produced by alternative splicing (PMID:25137017).

Protocols

Product Specific Protocols
FC protocol for TTK antibody 10381-1-APDownload protocol
IF protocol for TTK antibody 10381-1-APDownload protocol
IHC protocol for TTK antibody 10381-1-APDownload protocol
IP protocol for TTK antibody 10381-1-APDownload protocol
WB protocol for TTK antibody 10381-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanIF

J Cell Biol

PP6 regulation of Aurora A-TPX2 limits NDC80 phosphorylation and mitotic spindle size

Authors - Tomoaki Sobajima

Oxid Med Cell Longev

Oxidative Stress Delays Prometaphase/Metaphase of the First Cleavage in Mouse Zygotes via the MAD2L1-Mediated Spindle Assembly Checkpoint.

Authors - Que Wu
humanWB,IF

J Nanobiotechnology

GRP75-driven, cell-cycle-dependent macropinocytosis of Tat/pDNA-Ca2+ nanoparticles underlies distinct gene therapy effect in ovarian cancer.

Authors - Linjia Su
humanIHC

Int J Cancer

Development and validation of a five-gene model to predict postoperative brain metastasis in operable lung adenocarcinoma.

Authors - Fangqiu Fu
humanIHC

Front Oncol

Identification and Validation of Hub Genes Associated with Bladder Cancer by Integrated Bioinformatics and Experimental Assays

Authors - Kang Chen
humanIHC

Front Mol Biosci

Characteristic Analysis of Featured Genes Associated With Stemness Indices in Colorectal Cancer.

Authors - Yongqu Lu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Zhiping (Verified Customer) (07-28-2022)

Very clear band

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
Loading...
||
New chat

Able

正在加载,请稍候...