Filter:
  • Western Blot (WB) analysis of various lysates using Beta Tubulin Polyclonal antibody (10094-1-AP)

    WB analysis using 10094-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10094-1-AP (Beta Tubulin antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using Beta Tubulin Polyclonal antibody (10094-1-AP)

    WB analysis using 10094-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10094-1-AP (beta Tubulin antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

  • Western Blot (WB) analysis of various lysates using Beta Tubulin Polyclonal antibody (10094-1-AP)

    WB analysis using 10094-1-AP

    Various lysates were subjected to SDS PAGE followed by western blot with 10094-1-AP (beta Tubulin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  • Immunoprecipitation (IP) experiment of mouse brain tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IP experiment of mouse brain using 10094-1-AP

    IP result of anti-Beta Tubulin (IP:10094-1-AP, 3ug; Detection:10094-1-AP 1:1000) with mouse brain tissue lysate 7500ug.

  • Immunohistochemistry (IHC) staining of human colon tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of human colon using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10094-1-AP (Beta Tubulin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human colon tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of human colon using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10094-1-AP (Beta Tubulin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of rat testis tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of rat testis using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded rat testis using 10094-1-AP (beta Tubulin antibody) at dilution of 1:50 (under 10x lens).

  • Immunohistochemistry (IHC) staining of rat testis tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of rat testis using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded rat testis using 10094-1-AP (beta Tubulin antibody) at dilution of 1:50 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human cerebellum tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of human cerebellum using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded human cerebellum using 10094-1-AP (beta Tubulin antibody) at dilution of 1:50 (under 40x lens).

  • Immunohistochemistry (IHC) staining of human cerebellum tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of human cerebellum using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded human cerebellum using 10094-1-AP (beta Tubulin antibody) at dilution of 1:50 (under 10x lens).

  • Immunohistochemistry (IHC) staining of mouse brain tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of mouse brain using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10094-1-AP (beta Tubulin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of mouse brain tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of mouse brain using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 10094-1-AP (beta Tubulin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunohistochemistry (IHC) staining of human colon tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of human colon using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10094-1-AP (beta Tubulin antibody) at dilution of 1:200 (under 10x lens).

  • Immunohistochemistry (IHC) staining of human colon tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IHC staining of human colon using 10094-1-AP

    Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 10094-1-AP (beta Tubulin antibody) at dilution of 1:200 (under 40x lens).

  • Immunofluorescence (IF) / fluorescent staining of mouse eye tissue using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IF Staining of mouse eye using 10094-1-AP

    Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse eye tissue using Beta Tubulin antibody (10094-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  • Immunofluorescence (IF) / fluorescent staining of HepG2 cells using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IF Staining of HepG2 using 10094-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 10094-1-AP (beta Tubulin antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  • Immunofluorescence (IF) / fluorescent staining of HeLa cells using Beta Tubulin Polyclonal antibody (10094-1-AP)

    IF Staining of HeLa using 10094-1-AP

    Immunofluorescent analysis of (4% PFA) fixed HeLa cells using Beta Tubulin antibody (10094-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  • Flow cytometry (FC) experiment of HepG2 cells using Beta Tubulin Polyclonal antibody (10094-1-AP)

    FC experiment of HepG2 using 10094-1-AP

    1x10^6 HepG2 cells were intracellularly stained with 0.25 ug Beta Tubulin Polyclonal antibody (10094-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

"Beta Tubulin Antibodies" Comparison

View side-by-side comparison of Beta Tubulin antibodies from other vendors to find the one that best suits your research needs.

Beta Tubulin Polyclonal antibody

Beta Tubulin Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA
Cat No. 10094-1-AP
Publications(1108)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA

Tubulin beta 3 chain, Tubulin beta III, β III tubulin , βIII tubulin , TUBB4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inU-251 cells, mouse kidney tissue, HEK-293 cells, rat kidney tissue, mouse brain tissue, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman colon tissue, human cerebellum tissue, mouse brain tissue, rat testis tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse eye tissue
Positive IF/ICC detected inHeLa cells, HepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10094-1-AP targets Beta Tubulin in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, rabbit, chicken, zebrafish, hamster, sheep, goat, fish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0136

Product name: Recombinant human tubulin-beta protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 57-294 aa of BC000748

Sequence: HKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTARGSQQYRALTVPELTQQMF

Predict reactive species
Full Name tubulin, beta 3
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 50-55 kDa
GenBank Accession NumberBC000748
Gene Symbol TUBB3
Gene ID (NCBI) 10381
RRIDAB_2210695
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13509
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

There are five tubulins in human cells: alpha, beta, gamma, delta, and epsilon. Tubulins are conserved across species. They form heterodimers, which multimerize to form a microtubule filament. An alpha and beta tubulin heterodimer is the basic structural unit of microtubules. The heterodimer does not come apart, once formed. The alpha and beta tubulins, which are each about 55 kDa MW, are homologous but not identical. Alpha, beta, and gamma tubulins have all been used as loading controls. Tubulin expression may vary according to resistance to antimicrobial and antimitotic drugs.

Protocols

Product Specific Protocols
IF protocol for Beta Tubulin antibody 10094-1-APDownload protocol
IHC protocol for Beta Tubulin antibody 10094-1-APDownload protocol
IP protocol for Beta Tubulin antibody 10094-1-APDownload protocol
WB protocol for Beta Tubulin antibody 10094-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Nat Biotechnol

Magnify is a universal molecular anchoring strategy for expansion microscopy

Authors - Aleksandra Klimas
mouseWB

Nat Nanotechnol

Long-term pulmonary exposure to multi-walled carbon nanotubes promotes breast cancer metastatic cascades.

Authors - Xuefei Lu
mouseWB

Cell Metab

TMEM41B acts as an ER scramblase required for lipoprotein biogenesis and lipid homeostasis.

Authors - Dong Huang
mouseWB

Cell Metab

Ejection of damaged mitochondria and their removal by macrophages ensure efficient thermogenesis in brown adipose tissue.

Authors - Marco Rosina
humanIF

Nat Cell Biol

Single-cell multi-omics profiling of human preimplantation embryos identifies cytoskeletal defects during embryonic arrest

Authors - Teng Wang
humanWB

Nat Immunol

The tumor suppressor PTEN has a critical role in antiviral innate immunity.

Authors - Shun Li

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

SONAL (Verified Customer) (11-14-2025)

good

  • Applications: Western Blot, Immunohistochemistry, Immunoprecipitation
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Beas 2 B Cells
FH

SONAL (Verified Customer) (11-14-2025)

good

  • Applications: Western Blot, Immunohistochemistry, Immunoprecipitation
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Beas 2 B Cells
FH

Dan (Verified Customer) (08-25-2025)

transfection done on 293T and C2C12 cells and 40ug loaded for western blot. two major bands seen at 56 and 72KD

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: 293T and C2C12
Beta Tubulin Antibody Western Blot validation (1:3000 dilution) in 293T and C2C12 (Cat no:10094-1-AP)
FH

PK (Verified Customer) (08-14-2024)

excellent

  • Applications: Western Blot
  • Primary Antibody Dilution: 3000
  • Cell Tissue Type: AC16
Beta Tubulin Antibody Western Blot validation (3000 dilution) in AC16 (Cat no:10094-1-AP)
FH

Susanne (Verified Customer) (11-25-2022)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 : 1000
  • Cell Tissue Type: human dermal fibroblasts (lysates)
Beta Tubulin Antibody Western Blot validation (1 : 1000 dilution) in human dermal fibroblasts (lysates) (Cat no:10094-1-AP)
FH

Macarena (Verified Customer) (10-07-2022)

excellent results. No non specific binding. The loading control of choice in my lab

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: cell lines
FH

parisa (Verified Customer) (12-03-2021)

We had the anti-mouse antibody and tried this anti-rabbit antibody which worked very well and will be helpful for us.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Hek293T
FH

Azita (Verified Customer) (06-02-2021)

Immunohistochemistry labelling of (4% PFA) fixed mice spinal cord tissues using Beta Tubulin Polyclonal Antibody at dilution of 1:50 showed strong labelling.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: mice spinal cord tissues
FH

Elise (Verified Customer) (12-27-2020)

Works perfectly well!

  • Applications: Western Blot
  • Cell Tissue Type: Human spermatozoa
Loading...
||
New chat Able
正在加载,请稍候...