• Featured Product
  • KD/KO Validated

VPS11 Polyclonal antibody

VPS11 Polyclonal Antibody for WB, FC (Intra), IP, ELISA

Cat No. 19140-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, FC (Intra), IP, ELISA

hVPS11, PP3476, RING finger protein 108, RNF108, Vacuolar protein sorting-associated protein 11 homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, human brain tissue, mouse pancreas tissue, mouse brain tissue, human kidney tissue, human heart tissue, HeLa cells, K-562 cells, rat brain tissue
Positive IP detected inHEK-293 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19140-1-AP targets VPS11 in WB, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag6227

Product name: Recombinant human VPS11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 689-941 aa of BC065563

Sequence: FQQIMHYHMQHEQYRQVISVCERHGEQDPSLWEQALSYFARKEEDCKEYVAAVLKHIENKNLMPPLLVVQTLAHNSTATLSVIRDYLVQKLQKQSQQIAQDELRVRRYREETTRIRQEIQELKASPKIFQKTKCSICNSALELPSVHFLCGHSFHQHCFESYSESDADCPTCLPENRKVMDMIRAQEQKRDLHDQFQHQLRCSNDSFSVIADYFGRGVFNKLTLLTDPPTARLTSSLEAGLQRDLLMHSRRGT

Predict reactive species
Full Name vacuolar protein sorting 11 homolog (S. cerevisiae)
Calculated Molecular Weight 108 kDa
Observed Molecular Weight 108-112 kDa
GenBank Accession NumberBC065563
Gene Symbol VPS11
Gene ID (NCBI) 55823
RRIDAB_10642572
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H270
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Vesicle-mediated protein sorting plays an important role in segregating intracellular molecules into distinct organelles. In yeast, Vps proteins are involved in the trafficking of endocytic and biosynthetic proteins to the vacuole, which functionally resembles the lysosome of higher organisms. VPS11 is the human homolog of the yeast class C Vps11 protein, a subunit of the HOPS (homotypic fusion and protein transport) complex. Mammalian Vps11 may play a role in vesicle-mediated protein trafficking to lysosomal compartments and membrane docking/fusion reactions of late endosomes/lysosomes.

Protocols

Product Specific Protocols
FC protocol for VPS11 antibody 19140-1-APDownload protocol
IP protocol for VPS11 antibody 19140-1-APDownload protocol
WB protocol for VPS11 antibody 19140-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Autophagy

SDC1-dependent TGM2 determines radiosensitivity in glioblastoma by coordinating EPG5-mediated fusion of autophagosomes with lysosomes

Authors - Wang Zheng
humanWB,IF

J Cell Sci

Late endosomal transport and tethering are coupled processes controlled by RILP and the cholesterol sensor ORP1L.

Authors - van der Kant Rik R
  • KO Validated
humanWB

J Mol Biol

Proteomic and Biochemical Comparison of the Cellular Interaction Partners of Human VPS33A and VPS33B.

Authors - Morag R Hunter
humanWB,IF

J Biol Chem

Characterization of the mammalian CORVET and HOPS complexes and their modular restructuring for endosome specificity.

Authors - Rik van der Kant
humanWB,IF

J Cell Sci

The topology of lymphotoxin β receptor accumulated upon endolysosomal dysfunction dictates the NF-κB signaling outcome.

Authors - Magdalena Banach-Orłowska
  • KD Validated
humanWB,IP

Biochem J

VPS18 recruits VPS41 to the human HOPS complex via a RING-RING interaction.

Authors - Morag R Hunter
Loading...
||
New chat

Able

正在加载,请稍候...