• Featured Product
  • KD/KO Validated

XBP1S/XBP1U Polyclonal antibody

XBP1S/XBP1U Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 24168-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, FC (Intra), ChIP, ELISA

XBP1, Tax-responsive element-binding protein 5, TREB-5, X box binding protein 1, X-box-binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HEK-293 cells, Jurkat cells, Raji cells
Positive IHC detected inhuman breast cancer tissue, mouse liver tissue, human colon cancer tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:5000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24168-1-AP targets XBP1S/XBP1U in WB, IHC, FC (Intra), ChIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21454

Product name: Recombinant human XBP1 protein

Source: e coli.-derived, PET30a

Tag: 6*His

Domain: 1-167 aa of BC000938

Sequence: MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAAL

Predict reactive species
Full Name X-box binding protein 1
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight ~32 kDa; ~60 kDa
GenBank Accession NumberBC000938
Gene Symbol XBP1
Gene ID (NCBI) 7494
RRIDAB_2879445
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen Affinity purified
UNIPROT IDP17861
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

XBP1 is also named as XBP2, belongs to the bZIP family. The X-box-binding protein-1 (XBP1) is a transcriptional regulator of the ER stress response that lies downstream of inositol-requiring enzyme 1 (IRE1α) activation (PMID: 14559994). IRE1α possesses both kinase and ribonuclease activity and processes XBP1 mRNA to produce an active transcription factor in response to ER stress (PMID: 11779464, 11780124). It has been found that upon accumulation of unfolded proteins in the endoplasmic reticulum, the mRNA of this gene is processed to an active form by an unconventional splicing mechanism that is mediated by the endonuclease inositol-requiring enzyme 1. The resulting loss of 26 nt from the spliced mRNA causes a frame-shift and an isoform XBP1S, which is the functionally active transcription factor. The isoform encoded by the unspliced mRNA, XBP1U, is constitutively expressed, and thought to function as a negative feedback regulator of XBP1S, which shuts off transcription of target genes during the recovery phase of ER stress (PMID: 11850408). The unspliced XBP1U isoform is composed of 261 amino acid residues, and the spliced XBP1S isoform is composed of 376 amino acid residues. The XBP1 antibody (24168-1-AP) can detect both XBP1U and XBP1S.

Protocols

Product Specific Protocols
FC protocol for XBP1S/XBP1U antibody 24168-1-APDownload protocol
IHC protocol for XBP1S/XBP1U antibody 24168-1-APDownload protocol
WB protocol for XBP1S/XBP1U antibody 24168-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
ratWB,IHC

J Hazard Mater

GRP78/IRE1 and cGAS/STING pathway crosstalk through CHOP facilitates iodoacetic acid-mediated testosterone decline

Authors - Li Mou

Aging Cell

HSPA12B Protects Against Age-Related Endothelial Cell Senescence by Regulating STING Degradation

Authors - Tingting Li
humanWB

J Ethnopharmacol

Network pharmacology, molecular docking, and in vitro experimental verification of the mechanism of Guanxining in treating diabetic atherosclerosis

Authors - Wenting Wang
mouseWB

Bioorg Chem

Dihydroartemisinin alleviates steatosis and inflammation in nonalcoholic steatohepatitis by decreasing endoplasmic reticulum stress and oxidative stress.

Authors - Tongxi Li
humanWB

J Virol

Inositol requiring enzyme 1α promotes Zika virus infection through regulating stearoyl-CoA desaturase 1 mediated lipid metabolism.

Authors - Yanxia Huang
  • KD Validated
mouseWB

Exp Ther Med

Apelin‑13 reduces high glucose‑induced mitochondrial dysfunction in cochlear hair cells by inhibiting endoplasmic reticulum stress

Authors - Zhiqiang Huo

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Carly (Verified Customer) (09-27-2019)

Used in an antibody array to identify proteins in human EDTA plasma.

  • Applications: Other,
Loading...
||
New chat

Able

正在加载,请稍候...