• Featured Product
  • KD/KO Validated

XBP-1U specific Polyclonal antibody

XBP-1U specific Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 25997-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

XBP1, Tax-responsive element-binding protein 5, TREB-5, X box binding protein 1, X-box-binding protein 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat spleen tissue, mouse spleen tissue
Positive IHC detected inhuman breast cancer tissue, human colon cancer tissue, human liver cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:200-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25997-1-AP targets XBP-1U specific in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21714

Product name: Recombinant human XBP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 167-261 aa of BC000938

Sequence: LRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN

Predict reactive species
Full Name X-box binding protein 1
Calculated Molecular Weight 261 aa, 29 kDa
Observed Molecular Weight 32 kDa
GenBank Accession NumberBC000938
Gene Symbol XBP1
Gene ID (NCBI) 7494
RRIDAB_2880326
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP17861
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

X-box-binding protein 1 (XBP1), also named as TREB5, is a 261 amino acid protein, which contains one bZIP domain and belongs to the bZIP family. XBP1 localizes in the nucleus and as a transcription factor is essential for hepatocyte growth, the differentiation of plasma cells, the immunoglobulin secretion, and the unfolded protein response. XBP1 has an association with major affective disorder. The molecular weight of protein generated from the spliced XBP1 mRNA is 54 kDa and protein generated from unspliced Xbp1 mRNA is 33 kDa. This antibody 25997-1-AP specially recognizes isoform XBP-1U.

Protocols

Product Specific Protocols
FC protocol for XBP-1U specific antibody 25997-1-APDownload protocol
IHC protocol for XBP-1U specific antibody 25997-1-APDownload protocol
WB protocol for XBP-1U specific antibody 25997-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Extracell Vesicles

A multi-omics approach identifies pancreatic cancer cell extracellular vesicles as mediators of the unfolded protein response in normal pancreatic epithelial cells.

Authors - Charles P Hinzman
mouseWB

Hepatology

Farnesoid X receptor signaling activates the hepatic X-box binding protein 1 pathway in vitro and in mice.

Authors - Xiaoying Liu
humanIHC,IF

Sci Adv

Identification of XBP1-u as a novel regulator of the MDM2/p53 axis using an shRNA library.

Authors - Can Huang
mouseWB

Acta Pharm Sin B

The substitution of SERCA2 redox cysteine 674 promotes pulmonary vascular remodeling by activating IRE1α/XBP1s pathway.

Authors - Weimin Yu
pigWB

Autophagy

Inhibition of USP14 influences alphaherpesvirus proliferation by degrading viral VP16 protein via ER stress-triggered selective autophagy.

Authors - Sheng-Li Ming
humanWB

Oncogene

Knockdown of TM9SF4 boosts ER stress to trigger cell death of chemoresistant breast cancer cells.

Authors - Yifei Zhu
Loading...
||
New chat Able
正在加载,请稍候...