FCRL5 Fusion Protein

Catalog number: Ag15716
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

FCRL5 fusion protein Ag15716 SDS-PAGE


Product Name:
human FCRL5-6*His fusion protein

Catalog No:
Ag15716

Source:
E. coli-derived, T-HIS

Peptide Sequence:
QRSETVTLYITGLTANRSGPFATGVAGGLLSIAGLAAGALLLYCWLSRKAGRKPASDPARSPSDSDSQEPTYHNVPAWEELQPVYTNANPRGENVVYSEVRIIQEKKKHAVASDPRHLRNKGSPIIYSEVKVASTPVSGSLFLASSAPHR
(828 - 978 aa encoded by BC101067)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top