FCRL5 Polyclonal antibody

• 

  WB analysis of Daudi using 26503-1-AP

  Daudi cells were subjected to SDS PAGE followed by western blot with 26503-1-AP (FCRL5 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Raji using 26503-1-AP

  Raji cells were subjected to SDS PAGE followed by western blot with 26503-1-AP (FCRL5 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

FCRL5 Polyclonal Antibody for WB, ELISA

Cat No. 26503-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

BXMAS1, CD307, Fc receptor homolog 5, Fc receptor like 5, Fc receptor like protein 5, FcR like protein 5, FCRH5, FCRL5, IRTA2, PRO820

---

Tested Applications

• Positive WB detected in: Daudi cells, Raji cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26503-1-AP targets FCRL5 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24351

  Product name: Recombinant human FCRL5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 245-375 aa of BC101067

  Sequence: FQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTV

• Full Name: Fc receptor-like 5
• Calculated Molecular Weight: 977 aa, 106 kDa
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: BC101067
• Gene Symbol: FCRL5
• Gene ID (NCBI): 83416
• RRID: AB_2880535
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RD9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

FCRL5, also known as CD307 or IRTA2, is a surface protein expressed selectively on B cells and plasma cells (PMID: 11290337). This protein has both an immunoreceptor tyrosine-based activation motif (ITAM)-like sequence and two consensus immunoreceptor tyrosine-based inhibitory motifs (ITIM) in its cytoplasmic region (PMID: 17522256). FCRL5 is implicated in B cell development and lymphomagenesis (PMID: 11290337; 11453668). It may have an immunoregulatory role in marginal zone B-cells.