Tested Applications
Positive WB detected in | Daudi cells, Raji cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
26503-1-AP targets FCRL5 in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag24351 Product name: Recombinant human FCRL5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 245-375 aa of BC101067 Sequence: FQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTV Predict reactive species |
Full Name | Fc receptor-like 5 |
Calculated Molecular Weight | 977 aa, 106 kDa |
Observed Molecular Weight | 100 kDa |
GenBank Accession Number | BC101067 |
Gene Symbol | FCRL5 |
Gene ID (NCBI) | 83416 |
RRID | AB_2880535 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q96RD9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
FCRL5, also known as CD307 or IRTA2, is a surface protein expressed selectively on B cells and plasma cells (PMID: 11290337). This protein has both an immunoreceptor tyrosine-based activation motif (ITAM)-like sequence and two consensus immunoreceptor tyrosine-based inhibitory motifs (ITIM) in its cytoplasmic region (PMID: 17522256). FCRL5 is implicated in B cell development and lymphomagenesis (PMID: 11290337; 11453668). It may have an immunoregulatory role in marginal zone B-cells.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for FCRL5 antibody 26503-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |