LMOD1 Fusion Protein

Catalog number: Ag7568
  • Print page
  • Download PDF

Be the first to review this product


$199.00€199.00£199.00

Freight/Packing £00.00

Size: 09µ/gram

Format: Liquid

Please visit your regions distributor:


You can also
Request A Quote

Images See all

LMOD1 fusion protein Ag7568 SDS-PAGE


Product Name:
human LMOD1-6*His fusion protein

Catalog No:
Ag7568

Source:
E. coli-derived, PET28a

Peptide Sequence:
MEELEKELDVVDPDGSVPVGLRQRNQTEKQSTGVYNREAMLNFCEKETKKLMQREMSMDESKQVETKTDAKNGEERGRDASKKALGPRRDSDLGKEPKRGGLKKSFSRDRDEAGGKSGEKPKEEKIIRGIDKGRVRAAVDKKEAGKDGRGEERAVATKKEEEKKGSDRNTGLSRDKDKKREEMKEVAKKEDDEKVKGGAPAAPPPPPPPLAPPLIMENLKNSLSPATQRKMGDKVLPAQEKNSRDQLLAAIRSSNLKQLKKVEVPKLLQ
(C-269aa encoded by BC001755)

Activity:
Not tested.

Endotoxin Level:
Please contact the lab for more information.

Back
to top