Tested Applications
| Positive WB detected in | DU 145 cells, PC-3 cells, BxPC-3 cells, MCF-7 cells |
| Positive IHC detected in | human pancreas cancer tissue, human tonsillitis tissue, human breast cancer tissue, human ovary tumor tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
23614-1-AP targets MUC1/CA15-3 C-terminal in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20366 Product name: Recombinant human CA15-3,MUC1 protein Source: e coli.-derived, PET30a Tag: 6*His Domain: 64-265 aa of BC120975 Sequence: NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Predict reactive species |
| Full Name | mucin 1, cell surface associated |
| Calculated Molecular Weight | 1264 aa, 123 kDa |
| Observed Molecular Weight | 23-28 kDa |
| GenBank Accession Number | BC120975 |
| Gene Symbol | MUC1/CA15-3 |
| Gene ID (NCBI) | 4582 |
| RRID | AB_2879304 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P15941 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MUC1 is a type I transmembrane glycoprotein expressed by various epithelial cells of the female reproductive tract, lung, breast, kidney, stomach, and pancreas. MUC1 is transcribed as a large precursor gene product, and upon translation, is cleaved in the endoplasmic reticulum, yielding two subunits: the large extracellular N-terminal subunit (MUC1-N, about 120-200 kDa) and the small cytoplasmic C-terminal subunit (MUC1-C, about 23-30 kDa). Among the known mucins, MUC1 is best studied and plays crucial roles in regulating many cellular properties, including cell proliferation, apoptosis, adhesion, and invasion. MUC1 is overexpressed in a wide range of human epithelial malignancies. This antibody was raised against the C-terminal region of human MUC1, thus it recognizes the 23-30 kDa cytoplasmic MUC1.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MUC1/CA15-3 C-terminal antibody 23614-1-AP | Download protocol |
| WB protocol for MUC1/CA15-3 C-terminal antibody 23614-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The MUC1 antibody (Cat# 23614-1-AP) has 22 citations across journals including Cell Death Discovery, ACS Sensors, Molecular Oncology, Analytical Chemistry, Respiratory Research, International Immunopharmacology, Molecular Carcinogenesis, Frontiers in Oncology, and Scientific Reports. Research fields span cancer biology (lung, bladder, ovarian, osteosarcoma), ferroptosis, ER stress/autophagy, inflammation, mucin biology, exosome profiling, and tissue engineering.
| Species | Application | Title |
|---|---|---|
Mater Today Bio Microfluidic-based oral mucoadhesive nanozyme microspheres for immune modulation of xerostomia. | ||
ACS Sens Rolling Circle Amplification-Assisted Flow Cytometry Approach for Simultaneous Profiling of Exosomal Surface Proteins. | ||
Cell Death Discov Loss of QKI in macrophage aggravates inflammatory bowel disease through amplified ROS signaling and microbiota disproportion. | ||
Cell Death Discov Silencing of lncRNA MALAT1 facilitates erastin-induced ferroptosis in endometriosis through miR-145-5p/MUC1 signaling. | ||
Apoptosis LCN2 aggravates sepsis-induced ALI by inhibiting MUC1 to activate ER-stress-autophagy induced ferroptosis via lactate/MCT1/AMPK/mTOR axis. | ||
Anal Chem Multivalence Aptamers Enhance Transmembrane Efficiency of Localized Catalytic Hairpin Assembly-Based Nanomachine for Sensitive Cell Imaging. |
