Use Able AI chat for product recommendations

Chromogranin A Monoclonal antibody

Chromogranin A Monoclonal Antibody for WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA

Cat No. 60135-2-Ig
Clone No.2A7D11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (1)

Applications

WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA

CGA, CHGA, 2A7D11, AL-11, Chromogranin-A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inrat adrenal gland tissue, SH-SY5Y cells
Positive IHC-Autostainer detected inhuman colorectal cancer tissue, human stomach cancer tissue, human pituitary adenoma tissue, human appendicitis tissue
Positive IHC detected inhuman pancreas cancer tissue, human colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman pancreas cancer tissue
Positive IF/ICC detected inNeuro-2a cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunohistochemistry (IHC)-AUTOSTAINERIHC-AUTOSTAINER : 1:3000-1:12000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

60135-2-Ig targets Chromogranin A in WB, IHC, IHC-Autostainer, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag0807

Product name: Recombinant human CHGA protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 158-457 aa of BC006459

Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG

Predict reactive species
Full Name chromogranin A (parathyroid secretory protein 1)
Calculated Molecular Weight 51 kDa
Observed Molecular Weight 70-75 kDa
GenBank Accession NumberBC006459
Gene Symbol Chromogranin A
Gene ID (NCBI) 1113
RRIDAB_2918358
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP10645
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.

Protocols

Product Specific Protocols
IF protocol for Chromogranin A antibody 60135-2-IgDownload protocol
IHC protocol for Chromogranin A antibody 60135-2-IgDownload protocol
WB protocol for Chromogranin A antibody 60135-2-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Identification of PRDX5 as A Target for The Treatment of Castration-Resistant Prostate Cancer

Authors - Rong Wang
mouseIF

Stem Cell Res Ther

Expansion of mouse castration-resistant intermediate prostate stem cells in vitro

Authors - Yalan Xu
ratIF

Front Microbiol

Tongbian decoction restores intestinal microbiota and activates 5-hydroxytryptamine signaling: implication in slow transit constipation

Authors - Hongjia Li
ratIF

Cell Tissue Res

Neurotoxic stimulation alters prosaposin levels in the salivary systems of rats

Authors - Farzana Khan
humanIF

Front Pharmacol

Development of a small cell lung cancer organoid model to study cellular interactions and survival after chemotherapy

Authors - Chandani Sen
humanWB

Cell Death Discov

SMARCA4 promotes lineage plasticity and enzalutamide resistance in prostate cancer by regulating PROX1 via H3K27 acetylation.

Authors - Chenwei Wu
Loading...
||
New chat

Able

正在加载,请稍候...