Lipocalin-2/NGAL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Lipocalin-2/NGAL Polyclonal antibody (31721-1-AP)

Lipocalin-2/NGAL Polyclonal Antibody for WB, IF-P, ELISA

Cat No. 31721-1-AP Copied!

Publications (13)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

LCN2, lipocalin 2, NGAL, 24p3, 25 kDa alpha-2-microglobulin-related subunit of MMP-9

• 

  WB analysis using 31721-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31721-1-AP (Lipocalin-2/NGAL antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 31721-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31721-1-AP (Lipocalin-2/NGAL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of mouse spleen using 31721-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse spleen tissue using Lipocalin-2/NGAL antibody (31721-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Lipocalin-2/NGAL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-29 cells, mouse bone marrow tissue, SW480 cells
• Positive IF-P detected in: mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31721-1-AP targets Lipocalin-2/NGAL in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0998

  Product name: Recombinant Human Lipocalin-2/NGAL protein (His Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-10*His

  Domain: 21-198 aa of NM_005564.5

  Sequence: QDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDG

• Full Name: lipocalin 2
• Calculated Molecular Weight: 23kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: NM_005564.5
• Gene Symbol: NGAL/LCN2
• Gene ID (NCBI): 3934
• RRID: AB_3670098
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P80188-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Lipocalin-2 (LCN-2) is a adipocytokine also referred to as neutrophil gelatinase-associated lipocalin (NGAL). Lipocalin-2 is a circulatory protein responsible for the transportation of small and hydrophobic molecules to target organs. Lipocalin-2 is used as a biomarker for acute and chronic renal injury. It is present in a large variety of cells including neutrophil, hepatocytes, lung, bone marrow, adipose tissue, macrophages, thymus, non-neoplastic breast duct, prostate, and renal cells. Different functions have been associated with Lipocalin-2, including antibacterial, anti-inflammatory, and protection against cell and tissue stress (PMID:34463264).

Publications

What published studies show

The Lipocalin-2/NGAL Polyclonal antibody (Cat# 31721-1-AP) has 13 citations published across 11 journals, including Pharmacological Research, Free Radical Biology and Medicine, International Immunopharmacology, FASEB Journal, Scientific Reports, Cell Molecular Gastroenterology and Hepatology, Renal Failure, Molecular Medicine Reports, Veterinary Research Communications, Archives of Immunology and Therapy Experimental, and bioRxiv. Research fields span kidney injury, oncology (NSCLC, cervical cancer), epilepsy, Crohn's disease, oxidative stress, inflammation, and ferroptosis.

Automatically generated from the 13 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Pharmacol Res; Lipocalin 2 (LCN2) confers acquired resistance to almonertinib in NSCLC through LCN2-MMP-9 signaling pathway; Authors - Chen Shi ; KD Validated
human	IF	Cell Mol Gastroenterol Hepatol; An Epigenetic Basis for Sustained Inflammatory Epithelial Progenitor Cell States in Crohn's Disease.; Authors - Tatiana A. Karakasheva
		Free Radic Biol Med; MICU1 deficiency exacerbates cisplatin-induced acute kidney injury by tubular apoptosis and mitochondrial dysfunction.; Authors - Boqing Dong
human,mouse	WB,IF	Free Radic Biol Med; Astrocytic LCN2 drives neuronal dysfunction in epilepsy by suppressing tunnel nanotube-mediated mitochondrial transfer via NLRP3 inflammasome activation.; Authors - Zixian Zhou ; KO Validated
		Int Immunopharmacol; The protective effect of Lcn2 activation on salivary gland injury in sialadenitis.; Authors - Guijuan Feng
mouse,human	WB	Int Immunopharmacol; N-acetylglucosamine ameliorates the transition from acute kidney injury to chronic kidney disease by reducing the accumulation of lipid droplets.; Authors - Ziyu Tang