Tested Applications
| Positive WB detected in | Jurkat cells, HepG2 cells, HeLa cells, K-562 cells, MOLT-4 cells |
| Positive IP detected in | Jurkat cells |
| Positive IF/ICC detected in | Caco-2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28186-1-AP targets PMS1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag28132 Product name: Recombinant human PMS1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 340-616 aa of BC096331 Sequence: LPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEE Predict reactive species |
| Full Name | PMS1 postmeiotic segregation increased 1 (S. cerevisiae) |
| Observed Molecular Weight | 106 kDa |
| GenBank Accession Number | BC096331 |
| Gene Symbol | PMS1 |
| Gene ID (NCBI) | 5378 |
| RRID | AB_2881083 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P54277 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PMS1 Homolog 1 is a member of the DNA mismatch repair enzymes (MMREs) which is to eliminate the mismatch of insertions and deletions as a consequence of DNA polymerase errors at DNA synthesis in eukaryotes. PMS1 and MLH1 could form a heterodimer MutLβ that belongs to MMREs (PMID:25619773). In the MMR system, the MutS complex recognizes the DNA mispairs firstly, and then the Mlh1-Pms1 and other associated proteins such as PCNA, RFC, ExoI were recruited, inducing Exonuclease 1 (Exo1)-dependent and -independent MMR pathways (PMID:24981171). Mutations in this gene cause hereditary nonpolyposis colorectal cancer(HNPCC), which is also known as Lynch syndrome. It was reported that PMS1 is a widely expressed protein and located in the nucleus. Alternative splicing allows for 4 isoforms of PMS1 protein.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PMS1 antibody 28186-1-AP | Download protocol |
| IP protocol for PMS1 antibody 28186-1-AP | Download protocol |
| WB protocol for PMS1 antibody 28186-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
What customers say
Two reviews were found for this product. One user (5/5) reported excellent performance in Western Blot for detecting recombinant PMS1 in pull-down experiments using human MLH1-PMS1 complex as prey, achieving clear results within seconds of exposure at a 1:1000 dilution. Another user (1/5) reported poor performance in Immunofluorescence on gastric mouse organoids at 1:100 dilution, describing the staining as aspecific and very weak. Overall, the product performs well for recombinant protein detection by WB but may have limitations in IF applications on certain tissues.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
valentina (Verified Customer) (12-11-2025) | used for the detection of recombinant PMS1. When the human MLH1-PMS1 complex was used as pray in pull down experiments (1 ug of recombinant MutLalpha complex was incubated with 50 ul of amylose resin coated with MBP-tagged protein used as a bait) western blot analysis of the result was obtained within a few seconds of exposure.
|
Daniela (Verified Customer) (03-17-2022) | The staining was aspecific and very weak.
 |
