Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PMS1 Polyclonal antibody

PMS1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 28186-1-AP
Reviews (2)
Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, IP, ELISA

HNPCC3, hPMS1, MLH2, PMSL1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PMS1 in ?

Tested Applications

Positive WB detected inJurkat cells, HepG2 cells, HeLa cells, K-562 cells, MOLT-4 cells
Positive IP detected inJurkat cells
Positive IF/ICC detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28186-1-AP targets PMS1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag28132

Product name: Recombinant human PMS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 340-616 aa of BC096331

Sequence: LPSTNSYENNKTDVSAADIVLSKTAETDVLFNKVESSGKNYSNVDTSVIPFQNDMHNDESGKNTDDCLNHQISIGDFGYGHCSSEISNIDKNTKNAFQDISMSNVSWENSQTEYSKTCFISSVKHTQSENGNKDHIDESGENEEEAGLENSSEISADEWSRGNILKNSVGENIEPVKILVPEKSLPCKVSNNNYPIPEQMNLNEDSCNKKSNVIDNKSGKVTAYDLLSNRVIKKPMSASALFVQDHRPQFLIENPKTSLEDATLQIEELWKTLSEEE

Predict reactive species
Full Name PMS1 postmeiotic segregation increased 1 (S. cerevisiae)
Observed Molecular Weight 106 kDa
GenBank Accession NumberBC096331
Gene Symbol PMS1
Gene ID (NCBI) 5378
RRIDAB_2881083
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP54277
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PMS1 Homolog 1 is a member of the DNA mismatch repair enzymes (MMREs) which is to eliminate the mismatch of insertions and deletions as a consequence of DNA polymerase errors at DNA synthesis in eukaryotes. PMS1 and MLH1 could form a heterodimer MutLβ that belongs to MMREs (PMID:25619773). In the MMR system, the MutS complex recognizes the DNA mispairs firstly, and then the Mlh1-Pms1 and other associated proteins such as PCNA, RFC, ExoI were recruited, inducing Exonuclease 1 (Exo1)-dependent and -independent MMR pathways (PMID:24981171). Mutations in this gene cause hereditary nonpolyposis colorectal cancer(HNPCC), which is also known as Lynch syndrome. It was reported that PMS1 is a widely expressed protein and located in the nucleus. Alternative splicing allows for 4 isoforms of PMS1 protein.

Protocols

Product Specific Protocols
IF protocol for PMS1 antibody 28186-1-APDownload protocol
IP protocol for PMS1 antibody 28186-1-APDownload protocol
WB protocol for PMS1 antibody 28186-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Reviews

    3.0 out of 5
Add a review

2 verified customer reviews

What customers say

Two reviews were found for this product. One user (5/5) reported excellent performance in Western Blot for detecting recombinant PMS1 in pull-down experiments using human MLH1-PMS1 complex as prey, achieving clear results within seconds of exposure at a 1:1000 dilution. Another user (1/5) reported poor performance in Immunofluorescence on gastric mouse organoids at 1:100 dilution, describing the staining as aspecific and very weak. Overall, the product performs well for recombinant protein detection by WB but may have limitations in IF applications on certain tissues.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


valentina (Verified Customer) (12-11-2025)

used for the detection of recombinant PMS1. When the human MLH1-PMS1 complex was used as pray in pull down experiments (1 ug of recombinant MutLalpha complex was incubated with 50 ul of amylose resin coated with MBP-tagged protein used as a bait) western blot analysis of the result was obtained within a few seconds of exposure.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000

Daniela (Verified Customer) (03-17-2022)

The staining was aspecific and very weak.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Gastric mouse organoids
PMS1 Antibody Immunofluorescence validation (1:100 dilution) in Gastric mouse organoids (Cat no:28186-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...