Tested Applications
| Positive WB detected in | human placenta tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28053-1-AP targets PPARD in WB, IHC, ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Cited Reactivity | human, mouse, bovine |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27817 Product name: Recombinant human PPARD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-73 aa of BC002715 Sequence: MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQMGCDGASCGSLNME Predict reactive species |
| Full Name | peroxisome proliferator-activated receptor delta |
| Calculated Molecular Weight | 50 kDa |
| Observed Molecular Weight | 50 kDa |
| GenBank Accession Number | BC002715 |
| Gene Symbol | PPARD |
| Gene ID (NCBI) | 5467 |
| RRID | AB_2918143 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q03181 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for PPARD antibody 28053-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The PPARD Polyclonal antibody (catalog number 28053-1-AP) has 6 total citations. These appear in journals including Journal of Translational Medicine, Antioxidants, Frontiers in Immunology, European Journal of Pharmacology, Chemical Biology & Interactions, and Journal of Cellular Biochemistry. The associated research fields span obesity and thermogenesis, bovine mastitis and autophagy, MASLD diagnosis, tumor immune escape and phagocytosis, tongue cancer, and PPARδ signaling. Most studies applied the antibody for Western blot, with one also using immunohistochemistry.
| Species | Application | Title |
|---|---|---|
J Transl Med IMPA2 ameliorates high-fat diet-induced obesity by enhancing adaptive thermogenesis in a Ca²⁺-activated mitochondrial biogenesis pathway. | ||
Antioxidants (Basel) Ginsenoside Rg1 Alleviates Blood-Milk Barrier Disruption in Subclinical Bovine Mastitis by Regulating Oxidative Stress-Induced Excessive Autophagy | ||
Front Immunol Development of a diagnostic model for MASLD and identification of daidzein as the potential drug using bioinformatics analysis and experiments. | ||
Eur J Pharmacol GW501516 facilitated tumor immune escape by inhibiting phagocytosis
| ||
Chem Biol Interact f25, a novel synthetic quinoline derivative, inhibits tongue cancer cell invasion and survival by the PPAR pathway in vitro and vivo | ||
