Use Able AI chat for product recommendations

TRPV1 Monoclonal antibody

TRPV1 Monoclonal Antibody for WB, ELISA

Cat No. 66983-1-Ig
Clone No. 1A3C9
Publications (71)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human and More (1)

Applications

WB, CoIP, ELISA

1A3C9, Osm 9 like TRP channel 1, Osm-9-like TRP channel 1, OTRPC1, Vanilloid receptor 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for TRPV1 in ?

Tested Applications

Positive WB detected inHepG2 cells, MDA-MB-468 cells, T-47D cells, HEK-293 cells, Y79 cells, HUVEC cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66983-1-Ig targets TRPV1 in WB, CoIP, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag18683

Product name: Recombinant human TRPV1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-203 aa of BC132820

Sequence: MKKWSSTDLGAAADPLQKDTCPDPLDGDPNSRPPPAKPQLSTAKSRTRLFGKGDSEEAFPVDCPHEEGELDSCPTITVSPVITIQRPGDGPTGARLLSQDSVAASTEKTLRLYDRRSIFEAVAQNNCQDLESLLLFLQKSKKHLTDNEFKDPETGKTCLLKAMLNLHDGQNTTIPLLLEIARQTDSLKELVNASYTDSYYKGQ

Predict reactive species
Full Name transient receptor potential cation channel, subfamily V, member 1
Calculated Molecular Weight 839 aa, 95 kDa
Observed Molecular Weight 105 kDa
GenBank Accession NumberBC132820
Gene Symbol TRPV1
Gene ID (NCBI) 7442
RRIDAB_2882302
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ8NER1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TRPV1, also named as VR1 or OTRPC1, belongs to the transient receptor potential (TRP) family and TRPV subfamily (PMID: 17579562). TRPV1 is a ligand-activated non-selective calcium permeant cation channel expressed predominantly by sensory neurons (PMID: 10821274). It is involved in detection of noxious chemical and thermal stimuli. TRPV1 plays an important role in inflammatory thermal hyperalgesia (PMID: 10764638; 10821274).

Protocols

Product Specific Protocols
WB protocol for TRPV1 antibody 66983-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

TRPV1 antibody (Cat# 66983-1-Ig) has 71 citations across 50+ journals including Nature Communications, PNAS, Cell Death & Disease, Phytomedicine, Journal of Ethnopharmacology, FASEB Journal, International Immunopharmacology, Frontiers in Pharmacology, and Molecular Pain. Research fields span pain neuroscience, inflammation, cancer, osteoarthritis, respiratory disease, liver/kidney injury, obesity, cardiovascular protection, and pharmacology/natural product research.

SpeciesApplicationTitle
WB,IF

Bioact Mater

Manganese oxide nanozyme-loaded CO-releasing halloysite nanotubes for remodeling colonic immune, microbiota, and intestinal barrier homeostasis with concurrent pain relief in ulcerative colitis.

Authors - He Zhang
humanWB

Nat Commun

Nanoparticle-mediated TRPV1 channel blockade amplifies cancer thermo-immunotherapy via heat shock factor 1 modulation

Authors - Ting Li

Adv Sci (Weinh)

Near Infrared Responsive Gold Nanorods Attenuate Osteoarthritis Progression by Targeting TRPV1

Authors - Weitong Li
WB

Research (Wash D C)

Bifunctional TRPV1 Targeted Magnetothermal Switch to Attenuate Osteoarthritis Progression

Authors - Zhongyang Lv

J Control Release

Ultrasound-responsive piezoelectric analgesic microspheres alleviate osteoarthritis pain.

Authors - Xinhe Li

Cell Death Dis

TRPV1 alleviates osteoarthritis by inhibiting M1 macrophage polarization via Ca2+/CaMKII/Nrf2 signaling pathway.

Authors - Zhongyang Lv

Reviews

    1.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer (Shihab S.) tested this TRPV1 antibody by immunofluorescence at 1:100 dilution on a cell type known to express TRPV1, but was unable to detect any signal despite multiple attempts. The reviewer noted that they have had similar difficulties with other TRPV1 antibodies in this particular tissue type, so the lack of signal may not reflect poorly on the antibody itself. They planned to test it on other cell/tissue types to further evaluate its staining capabilities.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Shihab (Verified Customer) (09-17-2021)

This antibody was tried in a cell type (cannot disclose) which has previously been shown to express plenty of TRPV1 signal. However, this antibody was unable to give any signal in various attempts at staining, even at 1:100 dilution. This is not to say that this anybody is not good because I have had trouble with various TRPV1 antibodies in this tissue type but it will be used in other cell/tissue type to see its staining capabilities

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
Loading...
||
New chat

Able™

正在加载,请稍候...