Tested Applications
| Positive WB detected in | HeLa cells, mouse liver tissue, HepG2 cells, PC-3 cells, THP-1 cells, Caco-2 cells, rat liver tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:10000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
82945-1-RR targets DGAT1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse, rat samples.
| Tested Reactivity | Human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32717 Product name: Recombinant human DGAT1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 200-300 aa of BC015762 Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM Predict reactive species |
| Full Name | diacylglycerol O-acyltransferase homolog 1 (mouse) |
| Calculated Molecular Weight | 488 aa, 55 kDa |
| Observed Molecular Weight | 45-55 kDa |
| GenBank Accession Number | BC015762 |
| Gene Symbol | DGAT1 |
| Gene ID (NCBI) | 8694 |
| RRID | AB_3391728 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O75907 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for DGAT1 antibody 82945-1-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DGAT1 Recombinant monoclonal antibody (Cat# 82945-1-RR) has 16 citations. These appear in journals including Nature Metabolism, Autophagy, Acta Pharmaceutica Sinica B, Cell Reports, Journal of Neuroinflammation, Phytomedicine, FEBS Journal, and Biochimica et Biophysica Acta. Research fields span lipid metabolism, hepatocellular carcinoma, breast cancer, glioblastoma, renal cell carcinoma, type 2 diabetes, rheumatoid arthritis, neuroinflammation, ferroptosis, and immune-metabolic crosstalk.
| Species | Application | Title |
|---|---|---|
Autophagy ATG9A-PLA2G6 axis reprograms phospholipid metabolism to drive metabolic liver disease and hepatocellular carcinoma. | ||
Acta Pharm Sin B Curcumin ameliorates metabolic dysfunction-associated steatotic liver disease via targeting triokinase/FMN cyclase to regulate the expression of glycerol-3-phosphate acyltransferase 3: Integration of chemical proteomics and transcriptomics.
| ||
J Neuroinflammation Integrated omics reveal the effects of vitamin D deficiency on gut microbiota and plasma metabolism in experimental autoimmune uveitis. | ||
Phytomedicine Sanmiao pill ameliorates rheumatoid arthritis via PPARγ-mediated lipid accumulation in macrophage: A multi-omics and experimental validation. | ||
Phytomedicine Integrated metabolomics and mass spectrometry imaging analysis reveal the efficacy and mechanism of Huangkui capsule on type 2 diabetic nephropathy |
Reviews
What customers say
The single review for this antibody is positive, rated 5 stars. The customer used it for immunohistochemistry on a mice xenograft tissue at a 1:200 dilution and reported successful staining. Their only suggestion was that the antibody might perform even better at a more diluted concentration. Overall, the feedback indicates the product works well for IHC applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Xue (Verified Customer) (02-27-2026) | It might be better to use a more diluted antibody.
 |
