PAOX Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PAOX Polyclonal antibody (18972-1-AP)

PAOX Polyclonal Antibody for WB, ELISA

Cat No. 18972-1-AP Copied!

Publications (15)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ChIP, ELISA

Synonyms

EC:1.5.3.13, PAO, Peroxisomal N(1)-acetyl-spermine/spermidine oxidase, UNQ1923/PRO4398

• 

  WB analysis using 18972-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 18972-1-AP (PAOX antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 18972-1-AP

  Rat pancreas tissue were subjected to SDS PAGE followed by western blot with 18972-1-AP (PAOX antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human stomach using 18972-1-AP

  human stomach tissue were subjected to SDS PAGE followed by western blot with 18972-1-AP (PAOX antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PAOX in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue, human stomach tissue, rat pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

18972-1-AP targets PAOX in WB, IHC, IF, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5777

  Product name: Recombinant human PAOX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 31-364 aa of BC032778

  Sequence: RLCGHSAFPHLRVLEATARAGGRIRSERCFGGVVEVGAHWIHGPSRGNPVFQLAAEYGLLGEKELSQENQLVETGGHVGLPSVSYASSGASVSLQLVAEMATLFYGLIDQTREFLHAAETPVPSVGEYLKKEIGQHVAGWTEDEETRKLKLAVLNSFFNLECCVSGTHSMDLVALAPFGEYTVLPGLDCTFSKGYQGLTNCMMAALPEDTVVFEKPVKTIHWNGSFQEAAFPGETFPVSVECEDGDRFPAHHVIVTVPLGFLREHLDTFFDPPLPAEKAEAIRKIGFGTNNKIFLEFEEPFWEPDCQLIQLVWEDTSPLEDAAPELQDAWFRKL

• Full Name: polyamine oxidase (exo-N4-amino)
• Calculated Molecular Weight: 511 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC032778
• Gene Symbol: PAOX
• Gene ID (NCBI): 196743
• RRID: AB_2159196
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6QHF9
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAOX, also known as PAO, belongs to the flavin monoamine oxidase family. PAOX is a FAD-dependent amine oxidase, which is constitutively expressed in nearly all tissues of the vertebrate organism. PAOX catalyzes the oxidation of N1-acetylspermine to spermidine and thus involved in the polyamine back-conversion. PAOX can also oxidize N1-acetylspermidine to putrescine. PAOX has 4 isoforms with the molecular weights of 7, 35, 52 and 56 kDa.

Publications

What published studies show

The PAOX polyclonal antibody (Cat# 18972-1-AP) has 15 citations spanning 13 journals, including Nature, PNAS, J Clin Invest, Theranostics, J Control Release, FASEB J, Sci Rep, Cell Cycle, Bone, and others. Research fields covered include polyamine metabolism, ferroptosis, cancer (bladder, prostate, lung), tau neuropathology, inflammation, obesity, fibrosis, bone biology, and reproductive physiology. Applications cited include WB, IHC, IF, and ChIP across human, mouse, and rat species.

Automatically generated from the 15 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nature; Polyamine-dependent metabolic shielding regulates alternative splicing.; Authors - Maria Ponce-Rodriguez
human	WB	Nature; Spermine is an endogenous iron chelator that inhibits ferroptosis; Authors - Man Li ; KO Validated
human	WB,IHC	Theranostics; Targeted Accumulation of Reactive Acrolein via Nanoparticle-embedded Reverse Temperature Hydrogel for Bladder Cancer Treatment.; Authors - Yingying Xu
mouse	WB	J Clin Invest; Aberrant AZIN2 and polyamine metabolism precipitates tau neuropathology.; Authors - Leslie A Sandusky-Beltran
human, mouse	WB	J Control Release; Targeting polyamine metabolism induces oxidative/carbonyl stress to reinvigorate antitumor immunity in prostate cancer.; Authors - Aijing Zhang
human	WB	Proc Natl Acad Sci U S A; Activation of polyamine catabolism promotes glutamine metabolism and creates a targetable vulnerability in lung cancer; Authors - Xinlu Han