Published Applications
| WB | See 31 publications below | 
Product Information
10230-1-AP targets beta actin in WB, ELISA applications and shows reactivity with human, mouse, rat, zebrafish samples.
| Tested Reactivity | human, mouse, rat, zebrafish | 
| Cited Reactivity | human, mouse, rat, pig, bovine | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag0297 Product name: Recombinant human beta actin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 14-167 aa of BC002409 Sequence: SGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYE Predict reactive species | 
                                    
| Full Name | actin, beta | 
| Calculated Molecular Weight | 375 aa, 42 kDa | 
| GenBank Accession Number | BC002409 | 
| Gene Symbol | Beta Actin | 
| Gene ID (NCBI) | 60 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P60709 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Background Information
Beta Actin, also named as ACTB and F-Actin, belongs to the actin family. Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells. Beta Actin has been widely used as the internal control in bioscience. At least six isoforms are known in mammals. ALPHA-actin was predominant in single cells and BETA-actin was major in the cultured cells. Nonmuscle BETA- and GAMMA-actin, also known as cytoplasmic actin, are predominantly expressed in nonmuscle cells. ALPHA-cardiac and α-skeletal actin are expressed in striated cardiac and skeletal muscles, respectively; two smooth muscle actins, ALPHA- and GAMMA-actin, are found primarily in vascular smooth muscle and enteric smooth muscle, respectively. Most actins consist of 376aa, while ACTG2 (rich in muscles) has 375aa and ACTG1(found in non-muscle cells) has only 374aa. This antibody can detect endogenous level of β-Actin and may cross-react with other isoforms of actin family.
 Note: Do not add Azium (Sodium Azide or Smite) into the dilution buffer. Azium is the HRP inhibitor which decreases the enzyme activity of HRP.
Publications
| Species | Application | Title | 
|---|---|---|
Brief Bioinform Mechanistic study of acupuncture on the pterygopalatine ganglion to improve allergic rhinitis: analysis of multi-target effects based on bioinformatics/network topology strategie | ||
Int J Nanomedicine Integration of Dual Targeting and Dual Therapeutic Modules Endows Self-Assembled Nanoparticles with Anti-Tumor Growth and Metastasis Functions. | ||
J Virol Pemetrexed alleviates piglet diarrhea by blocking the interaction between porcine epidemic diarrhea virus nucleocapsid protein and Ezrin | ||
J Nat Prod Ergone Derivatives from the Deep-Sea-Derived Fungus Aspergillus terreus YPGA10 and 25,28-Dihydroxyergone-Induced Apoptosis in Human Colon Cancer SW620 Cells | ||
J Cell Biochem Dependence of artesunate on long noncoding RNA-RP11 to inhibit epithelial-mesenchymal transition of hepatocellular carcinoma. | ||
Biol Trace Elem Res The Protective Effect of Selenium on Bovine Mammary Epithelial Cell Injury Caused by Depression of Thioredoxin Reductase. | 
